F263444

General Info

Members Datasets Scaffolds Average Seq Length
173 123 173 229

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_98_c1|nmdc:mga0yw44_98_c1_17612_18301
Length 209
Sequence MSDVIPQHIGYIVDGNRRWAKSHGLPTYEGHLAGYNAILDVVLATVDAGVKYVSAYTFSTENWKRSEDEVSRLMGLTLKMLTADIGILQKNNIRLQVLGSRERLSTLAVCFNYGGHQEIADACRKIVQAGTPAEEITPDLIAAHLYAPDVPPIDVIVRTSGEQRLSNFMLWRASYSEFLSLEKMWPDMTKDDVTAILEEYSRRGRRFGG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
66 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
68 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
69 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
70 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
71 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
72 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
80 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
81 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
82 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
83 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
84 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
85 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
86 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
87 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
88 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
89 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
90 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
91 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
92 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
98 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
99 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
100 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
104 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
109 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
110 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
111 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
114 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
115 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
116 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
117 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
118 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
119 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
120 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
122 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
123 3300053738 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.81
Nodule 0
Rhizoplane 1.16
Rhizosphere 75.14
Stem 0
Stem Tuber 0
Unclassified 2.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12636410 2162886012 Bacteria 7606
2 MBSR1b_contig_5220965 2162886012 Bacteria 5769
3 JGI24740J21852_10001357 3300001979 Bacteria 11170
4 JGI24737J22298_10000814 3300001990 Bacteria 11066
5 JGI24743J22301_10010548 3300001991 Bacteria 1651
6 JGI24735J21928_10000107 3300002067 Bacteria 30612
7 rootH1_10023981 3300003316 Bacteria 29521
8 rootH2_10000659 3300003320 Bacteria 146718
9 rootH2_10302552 3300003320 Bacteria 1721
10 rootH1_10058345 3300003323 Bacteria 42716
11 JGI25405J52794_10007187 3300003911 Bacteria 2049
12 Ga0065715_10089232 3300005293 Bacteria 12126
13 Ga0070683_100001508 3300005329 Bacteria 17978
14 Ga0070670_100373573 3300005331 Bacteria 1255
15 Ga0070660_100000099 3300005339 Bacteria 52371
16 Ga0070660_100030588 3300005339 Bacteria 4039
17 Ga0070692_10017754 3300005345 Bacteria 3409
18 Ga0070675_100431069 3300005354 Bacteria 1180
19 Ga0070659_100015390 3300005366 Bacteria 5729
20 Ga0070662_100005004 3300005457 Bacteria 8429
21 Ga0070681_10112419 3300005458 Bacteria 2663
22 Ga0068855_100000138 3300005563 Bacteria 92676
23 Ga0068855_100000364 3300005563 Bacteria 56128
24 Ga0068855_100001636 3300005563 Bacteria 28089
25 Ga0070664_100001935 3300005564 Bacteria 16648
26 Ga0068857_100000117 3300005577 Bacteria 47726
27 Ga0068854_100058515 3300005578 Unclassified 2782
28 Ga0068856_100000354 3300005614 Bacteria 50023
29 Ga0068852_100768597 3300005616 Bacteria 976
30 Ga0068863_100446199 3300005841 Bacteria 1269
31 Ga0081455_10000006 3300005937 Bacteria 323066
32 Ga0075365_10000091 3300006038 Bacteria 26191
33 Ga0075364_10000244 3300006051 Bacteria 26177
34 Ga0075367_10000110 3300006178 Bacteria 23417
35 Ga0075366_10000943 3300006195 Bacteria 14152
36 Ga0075370_10002351 3300006353 Bacteria 8747
37 Ga0075370_10039406 3300006353 Bacteria 2662
38 Ga0075370_10058625 3300006353 Bacteria 2190
39 Ga0075428_100061007 3300006844 Bacteria 4129
40 Ga0068865_100001723 3300006881 Bacteria 12834
41 Ga0105240_10000004 3300009093 Bacteria 708156
42 Ga0105240_10005031 3300009093 Bacteria 19837
43 Ga0105240_10009236 3300009093 Bacteria 13988
44 Ga0105245_10909075 3300009098 Bacteria 922
45 Ga0105241_10674547 3300009174 Bacteria 941
46 Ga0105237_10000001 3300009545 Bacteria 1009213
47 Ga0105032_100003 3300009979 Bacteria 186985
48 Ga0105032_100022 3300009979 Bacteria 40670
49 Ga0105239_10001619 3300010375 Bacteria 29743
50 Ga0105239_10138957 3300010375 Bacteria 2706
51 Ga0105246_10002269 3300011119 Bacteria 11601
52 Ga0157373_10103659 3300013100 Bacteria 2001
53 Ga0157371_10024164 3300013102 Bacteria 4439
54 Ga0157371_10091224 3300013102 Unclassified 2158
55 Ga0157371_10528496 3300013102 Bacteria 873
56 Ga0157370_10000706 3300013104 Bacteria 41789
57 Ga0157370_10001253 3300013104 Bacteria 31691
58 Ga0157370_10142153 3300013104 Unclassified 2236
59 Ga0157369_10000024 3300013105 Bacteria 225851
60 Ga0157369_10000444 3300013105 Bacteria 54827
61 Ga0157369_10002588 3300013105 Bacteria 21632
62 Ga0157374_10000501 3300013296 Bacteria 35418
63 Ga0157372_10000002 3300013307 Bacteria 687862
64 Ga0157372_10000008 3300013307 Bacteria 305449
65 Ga0157372_10020496 3300013307 Bacteria 7135
66 Ga0157377_10005025 3300014745 Bacteria 6174
67 Ga0207647_10000315 3300025904 Bacteria 40274
68 Ga0207707_10277804 3300025912 Unclassified 1451
69 Ga0207695_10000009 3300025913 Bacteria 1034276
70 Ga0207695_10008875 3300025913 Bacteria 12517
71 Ga0207695_10040778 3300025913 Bacteria 4973
72 Ga0207671_10000003 3300025914 Bacteria 1065461
73 Ga0207657_10001204 3300025919 Bacteria 27540
74 Ga0207657_10068646 3300025919 Bacteria 3011
75 Ga0207649_10223083 3300025920 Unclassified 1344
76 Ga0207687_10831178 3300025927 Bacteria 789
77 Ga0207690_10040919 3300025932 Bacteria 3033
78 Ga0207690_10049931 3300025932 Bacteria 2790
79 Ga0207706_10000053 3300025933 Bacteria 114286
80 Ga0207704_10000687 3300025938 Bacteria 14978
81 Ga0207661_10001144 3300025944 Bacteria 17701
82 Ga0207679_10000193 3300025945 Bacteria 49103
83 Ga0207667_10000005 3300025949 Bacteria 715503
84 Ga0207667_10000434 3300025949 Bacteria 56114
85 Ga0207667_10009853 3300025949 Bacteria 11221
86 Ga0207640_10426313 3300025981 Bacteria 1087
87 Ga0207702_10000190 3300026078 Bacteria 73848
88 Ga0207702_10763188 3300026078 Bacteria 955
89 Ga0207674_10000590 3300026116 Bacteria 47749
90 Ga0207698_10656701 3300026142 Bacteria 1039
91 Ga0209813_10000934 3300027866 Bacteria 6561
92 Ga0209974_10002242 3300027876 Bacteria 7027
93 Ga0314311_1210496 3300030733 Bacteria 2063
94 Ga0316178_1153280 3300030735 Bacteria 2432
95 Ga0316180_1183998 3300030736 Bacteria 2934
96 Ga0316183_1010007 3300030742 Bacteria 20400
97 Ga0316183_1056756 3300030742 Bacteria 10430
98 Ga0316183_1059735 3300030742 Unclassified 1304
99 Ga0316183_1072964 3300030742 Unclassified 1114
100 Ga0316183_1085329 3300030742 Unclassified 2034
101 Ga0316181_1063761 3300030744 Bacteria 284591
102 Ga0316181_1262238 3300030744 Unclassified 1856
103 Ga0316182_1038083 3300030745 Bacteria 7944
104 Ga0316182_1039048 3300030745 Bacteria 11178
105 Ga0316182_1229622 3300030745 Unclassified 888
106 Ga0316182_1407660 3300030745 Bacteria 9406
107 Ga0307406_10000002 3300031901 Bacteria 255753
108 Ga0307406_10002500 3300031901 Bacteria 10016
109 Ga0307414_10710257 3300032004 Unclassified 911
110 Ga0395899_0011870 3300037312 Bacteria 6671
111 Ga0395900_0000001 3300037418 Bacteria 931146
112 Ga0395898_0000002 3300037466 Bacteria 931013
113 Ga0395901_0000400 3300038443 Bacteria 51851
114 Ga0395901_0183116 3300038443 Unclassified 2197
115 Ga0439438_017707 3300041405 Bacteria 2043
116 Ga0439447_018362 3300041407 Bacteria 1887
117 Ga0439461_0010680 3300041410 Bacteria 1690
118 Ga0439461_0012884 3300041410 Bacteria 1570
119 Ga0439466_0029061 3300041411 Bacteria 1904
120 Ga0439442_014333 3300042002 Bacteria 1631
121 Ga0439432_001021 3300042006 Bacteria 10592
122 Ga0439432_092019 3300042006 Bacteria 912
123 Ga0450911_008373 3300042115 Bacteria 1475
124 Ga0450920_000342 3300042122 Bacteria 7137
125 Ga0450906_004039 3300042145 Bacteria 3104
126 Ga0439446_0000005 3300042156 Bacteria 101649
127 Ga0439446_0000181 3300042156 Bacteria 11104
128 Ga0450909_006297 3300042185 Bacteria 1711
129 Ga0439434_0018592 3300042435 Bacteria 2082
130 Ga0439434_0020252 3300042435 Bacteria 1996
131 Ga0439464_0000002 3300042439 Bacteria 79371
132 Ga0439464_0041579 3300042439 Bacteria 1311
133 Ga0450918_001386 3300042531 Bacteria 4852
134 Ga0450918_017426 3300042531 Bacteria 1250
135 Ga0466972_0195407 3300044658 Unclassified 948
136 Ga0466965_0000073 3300044683 Bacteria 29903
137 Ga0466970_0139613 3300044765 Unclassified 1334
138 Ga0495638_0000108 3300046460 Bacteria 132914
139 Ga0495638_0000173 3300046460 Bacteria 100531
140 Ga0495588_0056809 3300046674 Bacteria 2021
141 Ga0495660_0000035 3300046810 Bacteria 199140
142 Ga0496113_0093878 3300048916 Bacteria 2317
143 Ga0496115_0000273 3300048918 Bacteria 45346
144 Ga0496124_0338260 3300048927 Bacteria 1070
145 Ga0501034_0002158 3300049571 Bacteria 24404
146 nmdc:mga03683_65041_c1 3300050489 Bacteria 1549
147 nmdc:mga00v17_331_c1 3300050491 Bacteria 26647
148 nmdc:mga0yw44_6_c1 3300050492 Bacteria 272478
149 nmdc:mga0yw44_98_c1 3300050492 Bacteria 30535
150 nmdc:mga0k408_3447_c1 3300050493 Bacteria 8375
151 nmdc:mga06z11_1040_c1 3300050494 Bacteria 10098
152 nmdc:mga06z11_243502_c1 3300050494 Bacteria 1057
153 nmdc:mga04h51_19745_c1 3300050495 Bacteria 2002
154 nmdc:mga07m45_4477_c1 3300050496 Bacteria 6834
155 nmdc:mga07m45_60411_c1 3300050496 Bacteria 2145
156 nmdc:mga07m45_9685_c1 3300050496 Bacteria 5007
157 Ga0500646_0000001 3300053090 Bacteria 273936
158 Ga0500583_0026529 3300053092 Bacteria 2490
159 Ga0500583_0068169 3300053092 Bacteria 1696
160 Ga0500651_0434073 3300053093 Unclassified 733
161 Ga0500641_0000001 3300053096 Bacteria 1115973
162 Ga0500556_0053718 3300053104 Unclassified 1465
163 Ga0500569_000004 3300053109 Bacteria 100531
164 Ga0500594_0000111 3300053118 Bacteria 23911
165 Ga0500652_000001 3300053131 Bacteria 946868
166 Ga0500655_000207 3300053133 Bacteria 14178
167 Ga0500577_0007517 3300053142 Bacteria 3060
168 Ga0500577_0125844 3300053142 Unclassified 1070
169 Ga0500588_0000056 3300053146 Bacteria 19233
170 Ga0500616_0000067 3300053153 Bacteria 236311
171 Ga0500616_0047173 3300053153 Bacteria 2288
172 Ga0500620_036259 3300053155 Bacteria 1594
173 Ga0500613_000353 3300053738 Unclassified 2362

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0434073 Ga0500651_0434073_64_660 198
2 3300006038 Ga0075365_10000091 Ga0075365_1000009118 209
3 3300050492 nmdc:mga0yw44_98_c1 nmdc:mga0yw44_98_c1_17612_18301 209
4 3300001979 JGI24740J21852_10001357 JGI24740J21852_1000135712 228
5 3300001990 JGI24737J22298_10000814 JGI24737J22298_1000081411 228
6 3300001991 JGI24743J22301_10010548 JGI24743J22301_100105482 228
7 3300002067 JGI24735J21928_10000107 JGI24735J21928_100001074 228
8 3300005329 Ga0070683_100001508 Ga0070683_1000015084 228
9 3300005339 Ga0070660_100030588 Ga0070660_1000305881 228
10 3300005354 Ga0070675_100431069 Ga0070675_1004310692 228
11 3300005366 Ga0070659_100015390 Ga0070659_1000153904 228
12 3300005457 Ga0070662_100005004 Ga0070662_1000050047 228
13 3300005564 Ga0070664_100001935 Ga0070664_10000193514 228
14 3300005577 Ga0068857_100000117 Ga0068857_1000001173 228
15 3300005614 Ga0068856_100000354 Ga0068856_10000035452 228
16 3300006195 Ga0075366_10000943 Ga0075366_1000094310 228
17 3300006353 Ga0075370_10002351 Ga0075370_100023518 228
18 3300006353 Ga0075370_10039406 Ga0075370_100394063 228
19 3300006881 Ga0068865_100001723 Ga0068865_1000017235 228
20 3300009098 Ga0105245_10909075 Ga0105245_109090752 228
21 3300010375 Ga0105239_10001619 Ga0105239_1000161915 228
22 3300011119 Ga0105246_10002269 Ga0105246_100022694 228
23 3300013100 Ga0157373_10103659 Ga0157373_101036592 228
24 3300013102 Ga0157371_10024164 Ga0157371_100241644 228
25 3300013104 Ga0157370_10001253 Ga0157370_100012535 228
26 3300013105 Ga0157369_10000444 Ga0157369_1000044441 228
27 3300013296 Ga0157374_10000501 Ga0157374_100005012 228
28 3300014745 Ga0157377_10005025 Ga0157377_100050255 228
29 3300025904 Ga0207647_10000315 Ga0207647_1000031512 228
30 3300025919 Ga0207657_10001204 Ga0207657_100012046 228
31 3300025920 Ga0207649_10223083 Ga0207649_102230832 228
32 3300025927 Ga0207687_10831178 Ga0207687_108311781 228
33 3300025932 Ga0207690_10040919 Ga0207690_100409192 228
34 3300025932 Ga0207690_10049931 Ga0207690_100499314 228
35 3300025933 Ga0207706_10000053 Ga0207706_1000005397 228
36 3300025938 Ga0207704_10000687 Ga0207704_100006875 228
37 3300025944 Ga0207661_10001144 Ga0207661_1000114416 228
38 3300025945 Ga0207679_10000193 Ga0207679_1000019323 228
39 3300026078 Ga0207702_10000190 Ga0207702_1000019028 228
40 3300026116 Ga0207674_10000590 Ga0207674_100005903 228
41 3300030742 Ga0316183_1072964 Ga0316183_10729642 228
42 3300030745 Ga0316182_1229622 Ga0316182_12296222 228
43 3300037312 Ga0395899_0011870 Ga0395899_0011870_4877_5563 228
44 3300037418 Ga0395900_0000001 Ga0395900_0000001_754516_755202 228
45 3300037466 Ga0395898_0000002 Ga0395898_0000002_350804_351490 228
46 3300038443 Ga0395901_0000400 Ga0395901_0000400_48204_48890 228
47 3300042439 Ga0439464_0000002 Ga0439464_0000002_39767_40453 228
48 3300044658 Ga0466972_0195407 Ga0466972_0195407_117_803 228
49 3300044683 Ga0466965_0000073 Ga0466965_0000073_17413_18099 228
50 3300044765 Ga0466970_0139613 Ga0466970_0139613_451_1137 228
51 3300046674 Ga0495588_0056809 Ga0495588_0056809_1138_1824 228
52 3300048916 Ga0496113_0093878 Ga0496113_0093878_860_1546 228
53 3300050493 nmdc:mga0k408_3447_c1 nmdc:mga0k408_3447_c1_1762_2448 228
54 3300050494 nmdc:mga06z11_243502_c1 nmdc:mga06z11_243502_c1_358_1044 228
55 3300050496 nmdc:mga07m45_4477_c1 nmdc:mga07m45_4477_c1_3351_4037 228
56 3300050496 nmdc:mga07m45_9685_c1 nmdc:mga07m45_9685_c1_3656_4342 228
57 3300053090 Ga0500646_0000001 Ga0500646_0000001_229546_230232 228
58 3300053096 Ga0500641_0000001 Ga0500641_0000001_613396_614082 228
59 3300053131 Ga0500652_000001 Ga0500652_000001_867345_868031 228
60 3300053155 Ga0500620_036259 Ga0500620_036259_450_1136 228
61 3300003323 rootH1_10058345 rootH1_1005834533 229
62 3300003911 JGI25405J52794_10007187 JGI25405J52794_100071872 229
63 3300005563 Ga0068855_100000364 Ga0068855_10000036420 229
64 3300005563 Ga0068855_100001636 Ga0068855_10000163611 229
65 3300005578 Ga0068854_100058515 Ga0068854_1000585152 229
66 3300005841 Ga0068863_100446199 Ga0068863_1004461992 229
67 3300005937 Ga0081455_10000006 Ga0081455_1000000695 229
68 3300006844 Ga0075428_100061007 Ga0075428_1000610076 229
69 3300009093 Ga0105240_10005031 Ga0105240_100050314 229
70 3300009979 Ga0105032_100003 Ga0105032_100003148 229
71 3300013102 Ga0157371_10528496 Ga0157371_105284962 229
72 3300013104 Ga0157370_10142153 Ga0157370_101421533 229
73 3300013105 Ga0157369_10000024 Ga0157369_1000002449 229
74 3300013105 Ga0157369_10002588 Ga0157369_100025888 229
75 3300025913 Ga0207695_10040778 Ga0207695_100407784 229
76 3300025949 Ga0207667_10000434 Ga0207667_1000043444 229
77 3300025949 Ga0207667_10009853 Ga0207667_1000985311 229
78 3300025981 Ga0207640_10426313 Ga0207640_104263132 229
79 3300030733 Ga0314311_1210496 Ga0314311_12104962 229
80 3300030735 Ga0316178_1153280 Ga0316178_11532802 229
81 3300030736 Ga0316180_1183998 Ga0316180_11839982 229
82 3300030742 Ga0316183_1010007 Ga0316183_101000714 229
83 3300030742 Ga0316183_1085329 Ga0316183_10853291 229
84 3300030744 Ga0316181_1262238 Ga0316181_12622382 229
85 3300030745 Ga0316182_1038083 Ga0316182_10380836 229
86 3300030745 Ga0316182_1407660 Ga0316182_14076607 229
87 3300032004 Ga0307414_10710257 Ga0307414_107102572 229
88 3300041405 Ga0439438_017707 Ga0439438_017707_617_1306 229
89 3300041407 Ga0439447_018362 Ga0439447_018362_593_1282 229
90 3300041410 Ga0439461_0012884 Ga0439461_0012884_100_789 229
91 3300041411 Ga0439466_0029061 Ga0439466_0029061_894_1583 229
92 3300042002 Ga0439442_014333 Ga0439442_014333_382_1071 229
93 3300042006 Ga0439432_001021 Ga0439432_001021_650_1339 229
94 3300042006 Ga0439432_092019 Ga0439432_092019_211_900 229
95 3300042115 Ga0450911_008373 Ga0450911_008373_97_786 229
96 3300042122 Ga0450920_000342 Ga0450920_000342_572_1261 229
97 3300042145 Ga0450906_004039 Ga0450906_004039_304_993 229
98 3300042156 Ga0439446_0000005 Ga0439446_0000005_44144_44860 229
99 3300042156 Ga0439446_0000181 Ga0439446_0000181_971_1660 229
100 3300042185 Ga0450909_006297 Ga0450909_006297_610_1299 229
101 3300042435 Ga0439434_0018592 Ga0439434_0018592_659_1375 229
102 3300042435 Ga0439434_0020252 Ga0439434_0020252_375_1064 229
103 3300042531 Ga0450918_017426 Ga0450918_017426_427_1116 229
104 3300046460 Ga0495638_0000173 Ga0495638_0000173_21735_22424 229
105 3300049571 Ga0501034_0002158 Ga0501034_0002158_5937_6626 229
106 3300050496 nmdc:mga07m45_60411_c1 nmdc:mga07m45_60411_c1_785_1474 229
107 3300053109 Ga0500569_000004 Ga0500569_000004_78108_78797 229
108 3300053118 Ga0500594_0000111 Ga0500594_0000111_11194_11886 229
109 3300053146 Ga0500588_0000056 Ga0500588_0000056_2100_2789 229
110 3300053153 Ga0500616_0000067 Ga0500616_0000067_115889_116578 229
111 3300003320 rootH2_10000659 rootH2_1000065997 230
112 3300009979 Ga0105032_100022 Ga0105032_10002238 230
113 3300013307 Ga0157372_10000008 Ga0157372_10000008287 230
114 3300030742 Ga0316183_1056756 Ga0316183_10567561 230
115 3300030742 Ga0316183_1059735 Ga0316183_10597352 230
116 3300030744 Ga0316181_1063761 Ga0316181_106376137 230
117 3300030745 Ga0316182_1039048 Ga0316182_10390481 230
118 3300042531 Ga0450918_001386 Ga0450918_001386_2079_2771 230
119 3300046810 Ga0495660_0000035 Ga0495660_0000035_47804_48496 230
120 3300048927 Ga0496124_0338260 Ga0496124_0338260_153_845 230
121 3300005339 Ga0070660_100000099 Ga0070660_10000009928 231
122 3300005345 Ga0070692_10017754 Ga0070692_100177542 231
123 3300006051 Ga0075364_10000244 Ga0075364_1000024419 231
124 3300006178 Ga0075367_10000110 Ga0075367_1000011017 231
125 3300006353 Ga0075370_10058625 Ga0075370_100586252 231
126 3300009093 Ga0105240_10000004 Ga0105240_10000004726 231
127 3300009093 Ga0105240_10009236 Ga0105240_100092368 231
128 3300009174 Ga0105241_10674547 Ga0105241_106745471 231
129 3300009545 Ga0105237_10000001 Ga0105237_100000011158 231
130 3300010375 Ga0105239_10138957 Ga0105239_101389572 231
131 3300013104 Ga0157370_10000706 Ga0157370_1000070610 231
132 3300013307 Ga0157372_10000002 Ga0157372_10000002703 231
133 3300025913 Ga0207695_10000009 Ga0207695_100000091108 231
134 3300025913 Ga0207695_10008875 Ga0207695_100088756 231
135 3300025914 Ga0207671_10000003 Ga0207671_100000031164 231
136 3300025919 Ga0207657_10068646 Ga0207657_100686463 231
137 3300026078 Ga0207702_10763188 Ga0207702_107631882 231
138 3300027866 Ga0209813_10000934 Ga0209813_100009342 231
139 3300038443 Ga0395901_0183116 Ga0395901_0183116_1233_1928 231
140 3300041410 Ga0439461_0010680 Ga0439461_0010680_776_1471 231
141 3300042439 Ga0439464_0041579 Ga0439464_0041579_270_965 231
142 3300046460 Ga0495638_0000108 Ga0495638_0000108_107643_108338 231
143 3300050489 nmdc:mga03683_65041_c1 nmdc:mga03683_65041_c1_675_1370 231
144 3300050491 nmdc:mga00v17_331_c1 nmdc:mga00v17_331_c1_18505_19200 231
145 3300050492 nmdc:mga0yw44_6_c1 nmdc:mga0yw44_6_c1_40006_40701 231
146 3300050494 nmdc:mga06z11_1040_c1 nmdc:mga06z11_1040_c1_2349_3044 231
147 3300050495 nmdc:mga04h51_19745_c1 nmdc:mga04h51_19745_c1_597_1292 231
148 3300053092 Ga0500583_0026529 Ga0500583_0026529_910_1605 231
149 3300053092 Ga0500583_0068169 Ga0500583_0068169_32_727 231
150 3300053142 Ga0500577_0007517 Ga0500577_0007517_499_1194 231
151 3300053142 Ga0500577_0125844 Ga0500577_0125844_275_970 231
152 3300053153 Ga0500616_0047173 Ga0500616_0047173_936_1631 231
153 3300053738 Ga0500613_000353 Ga0500613_000353_505_1200 231
154 3300005458 Ga0070681_10112419 Ga0070681_101124192 232
155 3300005563 Ga0068855_100000138 Ga0068855_10000013853 232
156 3300013102 Ga0157371_10091224 Ga0157371_100912242 232
157 3300013307 Ga0157372_10020496 Ga0157372_100204962 232
158 3300025912 Ga0207707_10277804 Ga0207707_102778042 232
159 3300025949 Ga0207667_10000005 Ga0207667_1000000559 232
160 3300031901 Ga0307406_10000002 Ga0307406_1000000278 232
161 3300048918 Ga0496115_0000273 Ga0496115_0000273_1625_2323 232
162 3300053104 Ga0500556_0053718 Ga0500556_0053718_462_1160 232
163 2162886012 MBSR1b_contig_12636410 MBSR1b_0617.00006590 233
164 2162886012 MBSR1b_contig_5220965 MBSR1b_0926.00004170 233
165 3300003316 rootH1_10023981 rootH1_100239816 233
166 3300003320 rootH2_10302552 rootH2_103025522 233
167 3300005293 Ga0065715_10089232 Ga0065715_100892326 233
168 3300005331 Ga0070670_100373573 Ga0070670_1003735732 233
169 3300005616 Ga0068852_100768597 Ga0068852_1007685972 233
170 3300026142 Ga0207698_10656701 Ga0207698_106567012 233
171 3300027876 Ga0209974_10002242 Ga0209974_100022424 233
172 3300031901 Ga0307406_10002500 Ga0307406_100025005 233
173 3300053133 Ga0500655_000207 Ga0500655_000207_7734_8435 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

103

208

0.97

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

12

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6szg-assembly1.cif.gz_A acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 0.9492 8 224
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9357 10 227
2dtn-assembly1.cif.gz_B crystal structure of helicobacter pylori undecaprenyl pyrophosphate synthase complexed with pyrophosphate 0.9301 11 233
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9287 6 226
5hc8-assembly1.cif.gz_A crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with dimethylallyl diphosphate 0.9265 9 233
ID Description Score Start End Superfamily
af_O14171_12_259_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9386 7 225 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9357 9 232 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9332 9 225 3.40.1180.10
2dtnB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9301 11 233 3.40.1180.10
af_A0A1D8PFD1_28_274_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9282 7 225 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A833D0S6-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9661 9 144 GO:0016094
GO:0045547
AF-A0A563C6S7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9656 8 161 GO:0008834
GO:0016094
GO:0045547
AF-X1FLT0-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9623 9 154 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A523VHM7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9614 9 174 GO:0008834
GO:0016094
GO:0045547
AF-A0A2M7XBG8-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9606 11 233 GO:0000287
GO:0016094
GO:0045547

Feature Viewer

pLDDT pTM Quality
83.95 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map