F263444
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 173 | 123 | 173 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300050492|nmdc:mga0yw44_98_c1|nmdc:mga0yw44_98_c1_17612_18301 |
| Length | 209 |
| Sequence | MSDVIPQHIGYIVDGNRRWAKSHGLPTYEGHLAGYNAILDVVLATVDAGVKYVSAYTFSTENWKRSEDEVSRLMGLTLKMLTADIGILQKNNIRLQVLGSRERLSTLAVCFNYGGHQEIADACRKIVQAGTPAEEITPDLIAAHLYAPDVPPIDVIVRTSGEQRLSNFMLWRASYSEFLSLEKMWPDMTKDDVTAILEEYSRRGRRFGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 28 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 29 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 34 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 39 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 68 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 69 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 70 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 71 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 72 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 73 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 74 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 75 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 76 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 77 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 78 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 79 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 80 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 81 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 82 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 83 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 84 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 85 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 86 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 87 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 88 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 89 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 90 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 91 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 92 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 93 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 94 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 95 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 96 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 100 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 101 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 102 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 104 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 105 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 106 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 107 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 108 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 109 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 110 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 111 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 112 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 113 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 114 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 115 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 116 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 117 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 118 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 119 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 120 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 121 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 122 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 123 | 3300053738 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.81 |
| Nodule | 0 |
| Rhizoplane | 1.16 |
| Rhizosphere | 75.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.89 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_12636410 | 2162886012 | Bacteria | 7606 |
| 2 | MBSR1b_contig_5220965 | 2162886012 | Bacteria | 5769 |
| 3 | JGI24740J21852_10001357 | 3300001979 | Bacteria | 11170 |
| 4 | JGI24737J22298_10000814 | 3300001990 | Bacteria | 11066 |
| 5 | JGI24743J22301_10010548 | 3300001991 | Bacteria | 1651 |
| 6 | JGI24735J21928_10000107 | 3300002067 | Bacteria | 30612 |
| 7 | rootH1_10023981 | 3300003316 | Bacteria | 29521 |
| 8 | rootH2_10000659 | 3300003320 | Bacteria | 146718 |
| 9 | rootH2_10302552 | 3300003320 | Bacteria | 1721 |
| 10 | rootH1_10058345 | 3300003323 | Bacteria | 42716 |
| 11 | JGI25405J52794_10007187 | 3300003911 | Bacteria | 2049 |
| 12 | Ga0065715_10089232 | 3300005293 | Bacteria | 12126 |
| 13 | Ga0070683_100001508 | 3300005329 | Bacteria | 17978 |
| 14 | Ga0070670_100373573 | 3300005331 | Bacteria | 1255 |
| 15 | Ga0070660_100000099 | 3300005339 | Bacteria | 52371 |
| 16 | Ga0070660_100030588 | 3300005339 | Bacteria | 4039 |
| 17 | Ga0070692_10017754 | 3300005345 | Bacteria | 3409 |
| 18 | Ga0070675_100431069 | 3300005354 | Bacteria | 1180 |
| 19 | Ga0070659_100015390 | 3300005366 | Bacteria | 5729 |
| 20 | Ga0070662_100005004 | 3300005457 | Bacteria | 8429 |
| 21 | Ga0070681_10112419 | 3300005458 | Bacteria | 2663 |
| 22 | Ga0068855_100000138 | 3300005563 | Bacteria | 92676 |
| 23 | Ga0068855_100000364 | 3300005563 | Bacteria | 56128 |
| 24 | Ga0068855_100001636 | 3300005563 | Bacteria | 28089 |
| 25 | Ga0070664_100001935 | 3300005564 | Bacteria | 16648 |
| 26 | Ga0068857_100000117 | 3300005577 | Bacteria | 47726 |
| 27 | Ga0068854_100058515 | 3300005578 | Unclassified | 2782 |
| 28 | Ga0068856_100000354 | 3300005614 | Bacteria | 50023 |
| 29 | Ga0068852_100768597 | 3300005616 | Bacteria | 976 |
| 30 | Ga0068863_100446199 | 3300005841 | Bacteria | 1269 |
| 31 | Ga0081455_10000006 | 3300005937 | Bacteria | 323066 |
| 32 | Ga0075365_10000091 | 3300006038 | Bacteria | 26191 |
| 33 | Ga0075364_10000244 | 3300006051 | Bacteria | 26177 |
| 34 | Ga0075367_10000110 | 3300006178 | Bacteria | 23417 |
| 35 | Ga0075366_10000943 | 3300006195 | Bacteria | 14152 |
| 36 | Ga0075370_10002351 | 3300006353 | Bacteria | 8747 |
| 37 | Ga0075370_10039406 | 3300006353 | Bacteria | 2662 |
| 38 | Ga0075370_10058625 | 3300006353 | Bacteria | 2190 |
| 39 | Ga0075428_100061007 | 3300006844 | Bacteria | 4129 |
| 40 | Ga0068865_100001723 | 3300006881 | Bacteria | 12834 |
| 41 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 42 | Ga0105240_10005031 | 3300009093 | Bacteria | 19837 |
| 43 | Ga0105240_10009236 | 3300009093 | Bacteria | 13988 |
| 44 | Ga0105245_10909075 | 3300009098 | Bacteria | 922 |
| 45 | Ga0105241_10674547 | 3300009174 | Bacteria | 941 |
| 46 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 47 | Ga0105032_100003 | 3300009979 | Bacteria | 186985 |
| 48 | Ga0105032_100022 | 3300009979 | Bacteria | 40670 |
| 49 | Ga0105239_10001619 | 3300010375 | Bacteria | 29743 |
| 50 | Ga0105239_10138957 | 3300010375 | Bacteria | 2706 |
| 51 | Ga0105246_10002269 | 3300011119 | Bacteria | 11601 |
| 52 | Ga0157373_10103659 | 3300013100 | Bacteria | 2001 |
| 53 | Ga0157371_10024164 | 3300013102 | Bacteria | 4439 |
| 54 | Ga0157371_10091224 | 3300013102 | Unclassified | 2158 |
| 55 | Ga0157371_10528496 | 3300013102 | Bacteria | 873 |
| 56 | Ga0157370_10000706 | 3300013104 | Bacteria | 41789 |
| 57 | Ga0157370_10001253 | 3300013104 | Bacteria | 31691 |
| 58 | Ga0157370_10142153 | 3300013104 | Unclassified | 2236 |
| 59 | Ga0157369_10000024 | 3300013105 | Bacteria | 225851 |
| 60 | Ga0157369_10000444 | 3300013105 | Bacteria | 54827 |
| 61 | Ga0157369_10002588 | 3300013105 | Bacteria | 21632 |
| 62 | Ga0157374_10000501 | 3300013296 | Bacteria | 35418 |
| 63 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 64 | Ga0157372_10000008 | 3300013307 | Bacteria | 305449 |
| 65 | Ga0157372_10020496 | 3300013307 | Bacteria | 7135 |
| 66 | Ga0157377_10005025 | 3300014745 | Bacteria | 6174 |
| 67 | Ga0207647_10000315 | 3300025904 | Bacteria | 40274 |
| 68 | Ga0207707_10277804 | 3300025912 | Unclassified | 1451 |
| 69 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 70 | Ga0207695_10008875 | 3300025913 | Bacteria | 12517 |
| 71 | Ga0207695_10040778 | 3300025913 | Bacteria | 4973 |
| 72 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 73 | Ga0207657_10001204 | 3300025919 | Bacteria | 27540 |
| 74 | Ga0207657_10068646 | 3300025919 | Bacteria | 3011 |
| 75 | Ga0207649_10223083 | 3300025920 | Unclassified | 1344 |
| 76 | Ga0207687_10831178 | 3300025927 | Bacteria | 789 |
| 77 | Ga0207690_10040919 | 3300025932 | Bacteria | 3033 |
| 78 | Ga0207690_10049931 | 3300025932 | Bacteria | 2790 |
| 79 | Ga0207706_10000053 | 3300025933 | Bacteria | 114286 |
| 80 | Ga0207704_10000687 | 3300025938 | Bacteria | 14978 |
| 81 | Ga0207661_10001144 | 3300025944 | Bacteria | 17701 |
| 82 | Ga0207679_10000193 | 3300025945 | Bacteria | 49103 |
| 83 | Ga0207667_10000005 | 3300025949 | Bacteria | 715503 |
| 84 | Ga0207667_10000434 | 3300025949 | Bacteria | 56114 |
| 85 | Ga0207667_10009853 | 3300025949 | Bacteria | 11221 |
| 86 | Ga0207640_10426313 | 3300025981 | Bacteria | 1087 |
| 87 | Ga0207702_10000190 | 3300026078 | Bacteria | 73848 |
| 88 | Ga0207702_10763188 | 3300026078 | Bacteria | 955 |
| 89 | Ga0207674_10000590 | 3300026116 | Bacteria | 47749 |
| 90 | Ga0207698_10656701 | 3300026142 | Bacteria | 1039 |
| 91 | Ga0209813_10000934 | 3300027866 | Bacteria | 6561 |
| 92 | Ga0209974_10002242 | 3300027876 | Bacteria | 7027 |
| 93 | Ga0314311_1210496 | 3300030733 | Bacteria | 2063 |
| 94 | Ga0316178_1153280 | 3300030735 | Bacteria | 2432 |
| 95 | Ga0316180_1183998 | 3300030736 | Bacteria | 2934 |
| 96 | Ga0316183_1010007 | 3300030742 | Bacteria | 20400 |
| 97 | Ga0316183_1056756 | 3300030742 | Bacteria | 10430 |
| 98 | Ga0316183_1059735 | 3300030742 | Unclassified | 1304 |
| 99 | Ga0316183_1072964 | 3300030742 | Unclassified | 1114 |
| 100 | Ga0316183_1085329 | 3300030742 | Unclassified | 2034 |
| 101 | Ga0316181_1063761 | 3300030744 | Bacteria | 284591 |
| 102 | Ga0316181_1262238 | 3300030744 | Unclassified | 1856 |
| 103 | Ga0316182_1038083 | 3300030745 | Bacteria | 7944 |
| 104 | Ga0316182_1039048 | 3300030745 | Bacteria | 11178 |
| 105 | Ga0316182_1229622 | 3300030745 | Unclassified | 888 |
| 106 | Ga0316182_1407660 | 3300030745 | Bacteria | 9406 |
| 107 | Ga0307406_10000002 | 3300031901 | Bacteria | 255753 |
| 108 | Ga0307406_10002500 | 3300031901 | Bacteria | 10016 |
| 109 | Ga0307414_10710257 | 3300032004 | Unclassified | 911 |
| 110 | Ga0395899_0011870 | 3300037312 | Bacteria | 6671 |
| 111 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 112 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 113 | Ga0395901_0000400 | 3300038443 | Bacteria | 51851 |
| 114 | Ga0395901_0183116 | 3300038443 | Unclassified | 2197 |
| 115 | Ga0439438_017707 | 3300041405 | Bacteria | 2043 |
| 116 | Ga0439447_018362 | 3300041407 | Bacteria | 1887 |
| 117 | Ga0439461_0010680 | 3300041410 | Bacteria | 1690 |
| 118 | Ga0439461_0012884 | 3300041410 | Bacteria | 1570 |
| 119 | Ga0439466_0029061 | 3300041411 | Bacteria | 1904 |
| 120 | Ga0439442_014333 | 3300042002 | Bacteria | 1631 |
| 121 | Ga0439432_001021 | 3300042006 | Bacteria | 10592 |
| 122 | Ga0439432_092019 | 3300042006 | Bacteria | 912 |
| 123 | Ga0450911_008373 | 3300042115 | Bacteria | 1475 |
| 124 | Ga0450920_000342 | 3300042122 | Bacteria | 7137 |
| 125 | Ga0450906_004039 | 3300042145 | Bacteria | 3104 |
| 126 | Ga0439446_0000005 | 3300042156 | Bacteria | 101649 |
| 127 | Ga0439446_0000181 | 3300042156 | Bacteria | 11104 |
| 128 | Ga0450909_006297 | 3300042185 | Bacteria | 1711 |
| 129 | Ga0439434_0018592 | 3300042435 | Bacteria | 2082 |
| 130 | Ga0439434_0020252 | 3300042435 | Bacteria | 1996 |
| 131 | Ga0439464_0000002 | 3300042439 | Bacteria | 79371 |
| 132 | Ga0439464_0041579 | 3300042439 | Bacteria | 1311 |
| 133 | Ga0450918_001386 | 3300042531 | Bacteria | 4852 |
| 134 | Ga0450918_017426 | 3300042531 | Bacteria | 1250 |
| 135 | Ga0466972_0195407 | 3300044658 | Unclassified | 948 |
| 136 | Ga0466965_0000073 | 3300044683 | Bacteria | 29903 |
| 137 | Ga0466970_0139613 | 3300044765 | Unclassified | 1334 |
| 138 | Ga0495638_0000108 | 3300046460 | Bacteria | 132914 |
| 139 | Ga0495638_0000173 | 3300046460 | Bacteria | 100531 |
| 140 | Ga0495588_0056809 | 3300046674 | Bacteria | 2021 |
| 141 | Ga0495660_0000035 | 3300046810 | Bacteria | 199140 |
| 142 | Ga0496113_0093878 | 3300048916 | Bacteria | 2317 |
| 143 | Ga0496115_0000273 | 3300048918 | Bacteria | 45346 |
| 144 | Ga0496124_0338260 | 3300048927 | Bacteria | 1070 |
| 145 | Ga0501034_0002158 | 3300049571 | Bacteria | 24404 |
| 146 | nmdc:mga03683_65041_c1 | 3300050489 | Bacteria | 1549 |
| 147 | nmdc:mga00v17_331_c1 | 3300050491 | Bacteria | 26647 |
| 148 | nmdc:mga0yw44_6_c1 | 3300050492 | Bacteria | 272478 |
| 149 | nmdc:mga0yw44_98_c1 | 3300050492 | Bacteria | 30535 |
| 150 | nmdc:mga0k408_3447_c1 | 3300050493 | Bacteria | 8375 |
| 151 | nmdc:mga06z11_1040_c1 | 3300050494 | Bacteria | 10098 |
| 152 | nmdc:mga06z11_243502_c1 | 3300050494 | Bacteria | 1057 |
| 153 | nmdc:mga04h51_19745_c1 | 3300050495 | Bacteria | 2002 |
| 154 | nmdc:mga07m45_4477_c1 | 3300050496 | Bacteria | 6834 |
| 155 | nmdc:mga07m45_60411_c1 | 3300050496 | Bacteria | 2145 |
| 156 | nmdc:mga07m45_9685_c1 | 3300050496 | Bacteria | 5007 |
| 157 | Ga0500646_0000001 | 3300053090 | Bacteria | 273936 |
| 158 | Ga0500583_0026529 | 3300053092 | Bacteria | 2490 |
| 159 | Ga0500583_0068169 | 3300053092 | Bacteria | 1696 |
| 160 | Ga0500651_0434073 | 3300053093 | Unclassified | 733 |
| 161 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 162 | Ga0500556_0053718 | 3300053104 | Unclassified | 1465 |
| 163 | Ga0500569_000004 | 3300053109 | Bacteria | 100531 |
| 164 | Ga0500594_0000111 | 3300053118 | Bacteria | 23911 |
| 165 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 166 | Ga0500655_000207 | 3300053133 | Bacteria | 14178 |
| 167 | Ga0500577_0007517 | 3300053142 | Bacteria | 3060 |
| 168 | Ga0500577_0125844 | 3300053142 | Unclassified | 1070 |
| 169 | Ga0500588_0000056 | 3300053146 | Bacteria | 19233 |
| 170 | Ga0500616_0000067 | 3300053153 | Bacteria | 236311 |
| 171 | Ga0500616_0047173 | 3300053153 | Bacteria | 2288 |
| 172 | Ga0500620_036259 | 3300053155 | Bacteria | 1594 |
| 173 | Ga0500613_000353 | 3300053738 | Unclassified | 2362 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053093 | Ga0500651_0434073 | Ga0500651_0434073_64_660 | 198 |
| 2 | 3300006038 | Ga0075365_10000091 | Ga0075365_1000009118 | 209 |
| 3 | 3300050492 | nmdc:mga0yw44_98_c1 | nmdc:mga0yw44_98_c1_17612_18301 | 209 |
| 4 | 3300001979 | JGI24740J21852_10001357 | JGI24740J21852_1000135712 | 228 |
| 5 | 3300001990 | JGI24737J22298_10000814 | JGI24737J22298_1000081411 | 228 |
| 6 | 3300001991 | JGI24743J22301_10010548 | JGI24743J22301_100105482 | 228 |
| 7 | 3300002067 | JGI24735J21928_10000107 | JGI24735J21928_100001074 | 228 |
| 8 | 3300005329 | Ga0070683_100001508 | Ga0070683_1000015084 | 228 |
| 9 | 3300005339 | Ga0070660_100030588 | Ga0070660_1000305881 | 228 |
| 10 | 3300005354 | Ga0070675_100431069 | Ga0070675_1004310692 | 228 |
| 11 | 3300005366 | Ga0070659_100015390 | Ga0070659_1000153904 | 228 |
| 12 | 3300005457 | Ga0070662_100005004 | Ga0070662_1000050047 | 228 |
| 13 | 3300005564 | Ga0070664_100001935 | Ga0070664_10000193514 | 228 |
| 14 | 3300005577 | Ga0068857_100000117 | Ga0068857_1000001173 | 228 |
| 15 | 3300005614 | Ga0068856_100000354 | Ga0068856_10000035452 | 228 |
| 16 | 3300006195 | Ga0075366_10000943 | Ga0075366_1000094310 | 228 |
| 17 | 3300006353 | Ga0075370_10002351 | Ga0075370_100023518 | 228 |
| 18 | 3300006353 | Ga0075370_10039406 | Ga0075370_100394063 | 228 |
| 19 | 3300006881 | Ga0068865_100001723 | Ga0068865_1000017235 | 228 |
| 20 | 3300009098 | Ga0105245_10909075 | Ga0105245_109090752 | 228 |
| 21 | 3300010375 | Ga0105239_10001619 | Ga0105239_1000161915 | 228 |
| 22 | 3300011119 | Ga0105246_10002269 | Ga0105246_100022694 | 228 |
| 23 | 3300013100 | Ga0157373_10103659 | Ga0157373_101036592 | 228 |
| 24 | 3300013102 | Ga0157371_10024164 | Ga0157371_100241644 | 228 |
| 25 | 3300013104 | Ga0157370_10001253 | Ga0157370_100012535 | 228 |
| 26 | 3300013105 | Ga0157369_10000444 | Ga0157369_1000044441 | 228 |
| 27 | 3300013296 | Ga0157374_10000501 | Ga0157374_100005012 | 228 |
| 28 | 3300014745 | Ga0157377_10005025 | Ga0157377_100050255 | 228 |
| 29 | 3300025904 | Ga0207647_10000315 | Ga0207647_1000031512 | 228 |
| 30 | 3300025919 | Ga0207657_10001204 | Ga0207657_100012046 | 228 |
| 31 | 3300025920 | Ga0207649_10223083 | Ga0207649_102230832 | 228 |
| 32 | 3300025927 | Ga0207687_10831178 | Ga0207687_108311781 | 228 |
| 33 | 3300025932 | Ga0207690_10040919 | Ga0207690_100409192 | 228 |
| 34 | 3300025932 | Ga0207690_10049931 | Ga0207690_100499314 | 228 |
| 35 | 3300025933 | Ga0207706_10000053 | Ga0207706_1000005397 | 228 |
| 36 | 3300025938 | Ga0207704_10000687 | Ga0207704_100006875 | 228 |
| 37 | 3300025944 | Ga0207661_10001144 | Ga0207661_1000114416 | 228 |
| 38 | 3300025945 | Ga0207679_10000193 | Ga0207679_1000019323 | 228 |
| 39 | 3300026078 | Ga0207702_10000190 | Ga0207702_1000019028 | 228 |
| 40 | 3300026116 | Ga0207674_10000590 | Ga0207674_100005903 | 228 |
| 41 | 3300030742 | Ga0316183_1072964 | Ga0316183_10729642 | 228 |
| 42 | 3300030745 | Ga0316182_1229622 | Ga0316182_12296222 | 228 |
| 43 | 3300037312 | Ga0395899_0011870 | Ga0395899_0011870_4877_5563 | 228 |
| 44 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_754516_755202 | 228 |
| 45 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_350804_351490 | 228 |
| 46 | 3300038443 | Ga0395901_0000400 | Ga0395901_0000400_48204_48890 | 228 |
| 47 | 3300042439 | Ga0439464_0000002 | Ga0439464_0000002_39767_40453 | 228 |
| 48 | 3300044658 | Ga0466972_0195407 | Ga0466972_0195407_117_803 | 228 |
| 49 | 3300044683 | Ga0466965_0000073 | Ga0466965_0000073_17413_18099 | 228 |
| 50 | 3300044765 | Ga0466970_0139613 | Ga0466970_0139613_451_1137 | 228 |
| 51 | 3300046674 | Ga0495588_0056809 | Ga0495588_0056809_1138_1824 | 228 |
| 52 | 3300048916 | Ga0496113_0093878 | Ga0496113_0093878_860_1546 | 228 |
| 53 | 3300050493 | nmdc:mga0k408_3447_c1 | nmdc:mga0k408_3447_c1_1762_2448 | 228 |
| 54 | 3300050494 | nmdc:mga06z11_243502_c1 | nmdc:mga06z11_243502_c1_358_1044 | 228 |
| 55 | 3300050496 | nmdc:mga07m45_4477_c1 | nmdc:mga07m45_4477_c1_3351_4037 | 228 |
| 56 | 3300050496 | nmdc:mga07m45_9685_c1 | nmdc:mga07m45_9685_c1_3656_4342 | 228 |
| 57 | 3300053090 | Ga0500646_0000001 | Ga0500646_0000001_229546_230232 | 228 |
| 58 | 3300053096 | Ga0500641_0000001 | Ga0500641_0000001_613396_614082 | 228 |
| 59 | 3300053131 | Ga0500652_000001 | Ga0500652_000001_867345_868031 | 228 |
| 60 | 3300053155 | Ga0500620_036259 | Ga0500620_036259_450_1136 | 228 |
| 61 | 3300003323 | rootH1_10058345 | rootH1_1005834533 | 229 |
| 62 | 3300003911 | JGI25405J52794_10007187 | JGI25405J52794_100071872 | 229 |
| 63 | 3300005563 | Ga0068855_100000364 | Ga0068855_10000036420 | 229 |
| 64 | 3300005563 | Ga0068855_100001636 | Ga0068855_10000163611 | 229 |
| 65 | 3300005578 | Ga0068854_100058515 | Ga0068854_1000585152 | 229 |
| 66 | 3300005841 | Ga0068863_100446199 | Ga0068863_1004461992 | 229 |
| 67 | 3300005937 | Ga0081455_10000006 | Ga0081455_1000000695 | 229 |
| 68 | 3300006844 | Ga0075428_100061007 | Ga0075428_1000610076 | 229 |
| 69 | 3300009093 | Ga0105240_10005031 | Ga0105240_100050314 | 229 |
| 70 | 3300009979 | Ga0105032_100003 | Ga0105032_100003148 | 229 |
| 71 | 3300013102 | Ga0157371_10528496 | Ga0157371_105284962 | 229 |
| 72 | 3300013104 | Ga0157370_10142153 | Ga0157370_101421533 | 229 |
| 73 | 3300013105 | Ga0157369_10000024 | Ga0157369_1000002449 | 229 |
| 74 | 3300013105 | Ga0157369_10002588 | Ga0157369_100025888 | 229 |
| 75 | 3300025913 | Ga0207695_10040778 | Ga0207695_100407784 | 229 |
| 76 | 3300025949 | Ga0207667_10000434 | Ga0207667_1000043444 | 229 |
| 77 | 3300025949 | Ga0207667_10009853 | Ga0207667_1000985311 | 229 |
| 78 | 3300025981 | Ga0207640_10426313 | Ga0207640_104263132 | 229 |
| 79 | 3300030733 | Ga0314311_1210496 | Ga0314311_12104962 | 229 |
| 80 | 3300030735 | Ga0316178_1153280 | Ga0316178_11532802 | 229 |
| 81 | 3300030736 | Ga0316180_1183998 | Ga0316180_11839982 | 229 |
| 82 | 3300030742 | Ga0316183_1010007 | Ga0316183_101000714 | 229 |
| 83 | 3300030742 | Ga0316183_1085329 | Ga0316183_10853291 | 229 |
| 84 | 3300030744 | Ga0316181_1262238 | Ga0316181_12622382 | 229 |
| 85 | 3300030745 | Ga0316182_1038083 | Ga0316182_10380836 | 229 |
| 86 | 3300030745 | Ga0316182_1407660 | Ga0316182_14076607 | 229 |
| 87 | 3300032004 | Ga0307414_10710257 | Ga0307414_107102572 | 229 |
| 88 | 3300041405 | Ga0439438_017707 | Ga0439438_017707_617_1306 | 229 |
| 89 | 3300041407 | Ga0439447_018362 | Ga0439447_018362_593_1282 | 229 |
| 90 | 3300041410 | Ga0439461_0012884 | Ga0439461_0012884_100_789 | 229 |
| 91 | 3300041411 | Ga0439466_0029061 | Ga0439466_0029061_894_1583 | 229 |
| 92 | 3300042002 | Ga0439442_014333 | Ga0439442_014333_382_1071 | 229 |
| 93 | 3300042006 | Ga0439432_001021 | Ga0439432_001021_650_1339 | 229 |
| 94 | 3300042006 | Ga0439432_092019 | Ga0439432_092019_211_900 | 229 |
| 95 | 3300042115 | Ga0450911_008373 | Ga0450911_008373_97_786 | 229 |
| 96 | 3300042122 | Ga0450920_000342 | Ga0450920_000342_572_1261 | 229 |
| 97 | 3300042145 | Ga0450906_004039 | Ga0450906_004039_304_993 | 229 |
| 98 | 3300042156 | Ga0439446_0000005 | Ga0439446_0000005_44144_44860 | 229 |
| 99 | 3300042156 | Ga0439446_0000181 | Ga0439446_0000181_971_1660 | 229 |
| 100 | 3300042185 | Ga0450909_006297 | Ga0450909_006297_610_1299 | 229 |
| 101 | 3300042435 | Ga0439434_0018592 | Ga0439434_0018592_659_1375 | 229 |
| 102 | 3300042435 | Ga0439434_0020252 | Ga0439434_0020252_375_1064 | 229 |
| 103 | 3300042531 | Ga0450918_017426 | Ga0450918_017426_427_1116 | 229 |
| 104 | 3300046460 | Ga0495638_0000173 | Ga0495638_0000173_21735_22424 | 229 |
| 105 | 3300049571 | Ga0501034_0002158 | Ga0501034_0002158_5937_6626 | 229 |
| 106 | 3300050496 | nmdc:mga07m45_60411_c1 | nmdc:mga07m45_60411_c1_785_1474 | 229 |
| 107 | 3300053109 | Ga0500569_000004 | Ga0500569_000004_78108_78797 | 229 |
| 108 | 3300053118 | Ga0500594_0000111 | Ga0500594_0000111_11194_11886 | 229 |
| 109 | 3300053146 | Ga0500588_0000056 | Ga0500588_0000056_2100_2789 | 229 |
| 110 | 3300053153 | Ga0500616_0000067 | Ga0500616_0000067_115889_116578 | 229 |
| 111 | 3300003320 | rootH2_10000659 | rootH2_1000065997 | 230 |
| 112 | 3300009979 | Ga0105032_100022 | Ga0105032_10002238 | 230 |
| 113 | 3300013307 | Ga0157372_10000008 | Ga0157372_10000008287 | 230 |
| 114 | 3300030742 | Ga0316183_1056756 | Ga0316183_10567561 | 230 |
| 115 | 3300030742 | Ga0316183_1059735 | Ga0316183_10597352 | 230 |
| 116 | 3300030744 | Ga0316181_1063761 | Ga0316181_106376137 | 230 |
| 117 | 3300030745 | Ga0316182_1039048 | Ga0316182_10390481 | 230 |
| 118 | 3300042531 | Ga0450918_001386 | Ga0450918_001386_2079_2771 | 230 |
| 119 | 3300046810 | Ga0495660_0000035 | Ga0495660_0000035_47804_48496 | 230 |
| 120 | 3300048927 | Ga0496124_0338260 | Ga0496124_0338260_153_845 | 230 |
| 121 | 3300005339 | Ga0070660_100000099 | Ga0070660_10000009928 | 231 |
| 122 | 3300005345 | Ga0070692_10017754 | Ga0070692_100177542 | 231 |
| 123 | 3300006051 | Ga0075364_10000244 | Ga0075364_1000024419 | 231 |
| 124 | 3300006178 | Ga0075367_10000110 | Ga0075367_1000011017 | 231 |
| 125 | 3300006353 | Ga0075370_10058625 | Ga0075370_100586252 | 231 |
| 126 | 3300009093 | Ga0105240_10000004 | Ga0105240_10000004726 | 231 |
| 127 | 3300009093 | Ga0105240_10009236 | Ga0105240_100092368 | 231 |
| 128 | 3300009174 | Ga0105241_10674547 | Ga0105241_106745471 | 231 |
| 129 | 3300009545 | Ga0105237_10000001 | Ga0105237_100000011158 | 231 |
| 130 | 3300010375 | Ga0105239_10138957 | Ga0105239_101389572 | 231 |
| 131 | 3300013104 | Ga0157370_10000706 | Ga0157370_1000070610 | 231 |
| 132 | 3300013307 | Ga0157372_10000002 | Ga0157372_10000002703 | 231 |
| 133 | 3300025913 | Ga0207695_10000009 | Ga0207695_100000091108 | 231 |
| 134 | 3300025913 | Ga0207695_10008875 | Ga0207695_100088756 | 231 |
| 135 | 3300025914 | Ga0207671_10000003 | Ga0207671_100000031164 | 231 |
| 136 | 3300025919 | Ga0207657_10068646 | Ga0207657_100686463 | 231 |
| 137 | 3300026078 | Ga0207702_10763188 | Ga0207702_107631882 | 231 |
| 138 | 3300027866 | Ga0209813_10000934 | Ga0209813_100009342 | 231 |
| 139 | 3300038443 | Ga0395901_0183116 | Ga0395901_0183116_1233_1928 | 231 |
| 140 | 3300041410 | Ga0439461_0010680 | Ga0439461_0010680_776_1471 | 231 |
| 141 | 3300042439 | Ga0439464_0041579 | Ga0439464_0041579_270_965 | 231 |
| 142 | 3300046460 | Ga0495638_0000108 | Ga0495638_0000108_107643_108338 | 231 |
| 143 | 3300050489 | nmdc:mga03683_65041_c1 | nmdc:mga03683_65041_c1_675_1370 | 231 |
| 144 | 3300050491 | nmdc:mga00v17_331_c1 | nmdc:mga00v17_331_c1_18505_19200 | 231 |
| 145 | 3300050492 | nmdc:mga0yw44_6_c1 | nmdc:mga0yw44_6_c1_40006_40701 | 231 |
| 146 | 3300050494 | nmdc:mga06z11_1040_c1 | nmdc:mga06z11_1040_c1_2349_3044 | 231 |
| 147 | 3300050495 | nmdc:mga04h51_19745_c1 | nmdc:mga04h51_19745_c1_597_1292 | 231 |
| 148 | 3300053092 | Ga0500583_0026529 | Ga0500583_0026529_910_1605 | 231 |
| 149 | 3300053092 | Ga0500583_0068169 | Ga0500583_0068169_32_727 | 231 |
| 150 | 3300053142 | Ga0500577_0007517 | Ga0500577_0007517_499_1194 | 231 |
| 151 | 3300053142 | Ga0500577_0125844 | Ga0500577_0125844_275_970 | 231 |
| 152 | 3300053153 | Ga0500616_0047173 | Ga0500616_0047173_936_1631 | 231 |
| 153 | 3300053738 | Ga0500613_000353 | Ga0500613_000353_505_1200 | 231 |
| 154 | 3300005458 | Ga0070681_10112419 | Ga0070681_101124192 | 232 |
| 155 | 3300005563 | Ga0068855_100000138 | Ga0068855_10000013853 | 232 |
| 156 | 3300013102 | Ga0157371_10091224 | Ga0157371_100912242 | 232 |
| 157 | 3300013307 | Ga0157372_10020496 | Ga0157372_100204962 | 232 |
| 158 | 3300025912 | Ga0207707_10277804 | Ga0207707_102778042 | 232 |
| 159 | 3300025949 | Ga0207667_10000005 | Ga0207667_1000000559 | 232 |
| 160 | 3300031901 | Ga0307406_10000002 | Ga0307406_1000000278 | 232 |
| 161 | 3300048918 | Ga0496115_0000273 | Ga0496115_0000273_1625_2323 | 232 |
| 162 | 3300053104 | Ga0500556_0053718 | Ga0500556_0053718_462_1160 | 232 |
| 163 | 2162886012 | MBSR1b_contig_12636410 | MBSR1b_0617.00006590 | 233 |
| 164 | 2162886012 | MBSR1b_contig_5220965 | MBSR1b_0926.00004170 | 233 |
| 165 | 3300003316 | rootH1_10023981 | rootH1_100239816 | 233 |
| 166 | 3300003320 | rootH2_10302552 | rootH2_103025522 | 233 |
| 167 | 3300005293 | Ga0065715_10089232 | Ga0065715_100892326 | 233 |
| 168 | 3300005331 | Ga0070670_100373573 | Ga0070670_1003735732 | 233 |
| 169 | 3300005616 | Ga0068852_100768597 | Ga0068852_1007685972 | 233 |
| 170 | 3300026142 | Ga0207698_10656701 | Ga0207698_106567012 | 233 |
| 171 | 3300027876 | Ga0209974_10002242 | Ga0209974_100022424 | 233 |
| 172 | 3300031901 | Ga0307406_10002500 | Ga0307406_100025005 | 233 |
| 173 | 3300053133 | Ga0500655_000207 | Ga0500655_000207_7734_8435 | 233 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6szg-assembly1.cif.gz_A | acinetobacter baumannii undecaprenyl pyrophosphate synthase (ab-upps) in complex with gr839 and gsk513 | 0.9492 | 8 | 224 |
| 1x07-assembly1.cif.gz_A | crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp | 0.9357 | 10 | 227 |
| 2dtn-assembly1.cif.gz_B | crystal structure of helicobacter pylori undecaprenyl pyrophosphate synthase complexed with pyrophosphate | 0.9301 | 11 | 233 |
| 1x09-assembly1.cif.gz_A | crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate | 0.9287 | 6 | 226 |
| 5hc8-assembly1.cif.gz_A | crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with dimethylallyl diphosphate | 0.9265 | 9 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14171_12_259_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9386 | 7 | 225 | 3.40.1180.10 |
| af_K7KA63_68_310_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9357 | 9 | 232 | 3.40.1180.10 |
| 5hc7A00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9332 | 9 | 225 | 3.40.1180.10 |
| 2dtnB00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9301 | 11 | 233 | 3.40.1180.10 |
| af_A0A1D8PFD1_28_274_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.9282 | 7 | 225 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A833D0S6-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9661 | 9 | 144 |
GO:0016094
GO:0045547 |
| AF-A0A563C6S7-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9656 | 8 | 161 |
GO:0008834
GO:0016094 GO:0045547 |
| AF-X1FLT0-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9623 | 9 | 154 |
GO:0000287
GO:0005829 GO:0008834 GO:0016094 GO:0045547 |
| AF-A0A523VHM7-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9614 | 9 | 174 |
GO:0008834
GO:0016094 GO:0045547 |
| AF-A0A2M7XBG8-F1-model_v4 | Isoprenyl transferase (EC 2.5.1.-) | 0.9606 | 11 | 233 |
GO:0000287
GO:0016094 GO:0045547 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar