F262757

General Info

Members Datasets Scaffolds Average Seq Length
173 113 346 398

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10006097|Ga0207695_100060978
Length 445
Sequence MLFCLPEFVGLTDFWSEHELTLPRGPRRHGTAGRRLTRRALGYNRVMSEVPRRAFLRGVTAATALSYSRVYGANERIQLGLIGCGERGRYDMGNFVKTGGVDVVALCDIWANNLDLAKKPANNPNVKTFSDHRQLLAMKDVDVALIGVPDHWHAPIAIDALNAGKDVYVEKPLTRTIEEGPMIVKAARVNKRVCQVGMQQRSGKHYLEAKREYMDTGKLGKVTLARTWWHGNGYHLRKAPATLQTLPSDLDWAHFLGPLKWRDWDPQQYWNWRAYLDFGGGQVTDLFTHWIDVVHMFMGKDIPTAGIAAGGVYNYKDGRTAPDTINVLLEYPSEFTATFEATLAPGANGAAQEFIGTQGRLYIDRGHYEFHPVGRNAQPTIVQASSNIDMDHVENFLACVKSREKPNGDVLVGHRSAQASHLGNISYMQKRRIDFDPVREEILPF

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
20 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
21 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
22 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
29 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
30 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
45 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
46 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
47 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
48 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
53 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
54 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
55 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
56 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
57 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
61 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
66 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
77 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
81 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
95 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
96 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
97 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
98 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
101 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
102 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
103 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
109 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
110 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
111 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
112 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 1.73
Rhizosphere 89.02
Stem 0
Stem Tuber 0
Unclassified 8.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10006097 3300025913 Bacteria 15729
2 Ga0070683_100000014 3300005329 Bacteria 221422
3 Ga0070683_100045282 3300005329 Bacteria 4060
4 Ga0070680_100177181 3300005336 Bacteria 1795
5 Ga0070660_100034631 3300005339 Bacteria 3817
6 Ga0070689_100028908 3300005340 Bacteria 4192
7 Ga0070671_100045302 3300005355 Bacteria 3656
8 Ga0070708_100112012 3300005445 Bacteria 2509
9 Ga0070699_100098273 3300005518 Bacteria 2565
10 Ga0070684_100000004 3300005535 Bacteria 231043
11 Ga0070684_100083296 3300005535 Bacteria 2834
12 Ga0070695_100004811 3300005545 Bacteria 7945
13 Ga0068855_100012210 3300005563 Bacteria 10383
14 Ga0068863_100147459 3300005841 Bacteria 2251
15 Ga0070717_10010888 3300006028 Bacteria 6885
16 Ga0070717_10019396 3300006028 Bacteria 5331
17 Ga0070717_10119096 3300006028 Bacteria 2260
18 Ga0075428_100083673 3300006844 Bacteria 3481
19 Ga0075431_100015410 3300006847 Bacteria 7743
20 Ga0075436_100006434 3300006914 Bacteria 8048
21 Ga0075436_100040324 3300006914 Bacteria 3223
22 Ga0105240_10002280 3300009093 Bacteria 31085
23 Ga0105240_10020167 3300009093 Bacteria 8898
24 Ga0105240_10041513 3300009093 Bacteria 5871
25 Ga0111539_10009001 3300009094 Bacteria 12638
26 Ga0105241_10145478 3300009174 Bacteria 1934
27 Ga0105241_10189000 3300009174 Bacteria 1713
28 Ga0105248_10091512 3300009177 Bacteria 3426
29 Ga0105237_10065002 3300009545 Bacteria 3644
30 Ga0105249_10013537 3300009553 Bacteria 7206
31 Ga0157373_10062541 3300013100 Bacteria 2636
32 Ga0157370_10013216 3300013104 Bacteria 8512
33 Ga0157370_10175657 3300013104 Unclassified 1991
34 Ga0157369_10005023 3300013105 Bacteria 15491
35 Ga0157369_10013394 3300013105 Bacteria 9275
36 Ga0157369_10076438 3300013105 Bacteria 3589
37 Ga0157369_10077525 3300013105 Bacteria 3562
38 Ga0157374_10004176 3300013296 Bacteria 12132
39 Ga0157374_10005958 3300013296 Bacteria 10309
40 Ga0157372_10014702 3300013307 Bacteria 8375
41 Ga0157372_10100492 3300013307 Bacteria 3301
42 Ga0157372_10613462 3300013307 Bacteria 1268
43 Ga0163163_10068873 3300014325 Bacteria 3522
44 Ga0213872_10000310 3300021361 Bacteria 41619
45 Ga0213876_10001985 3300021384 Bacteria 12232
46 Ga0213875_10000010 3300021388 Bacteria 370268
47 Ga0213875_10006955 3300021388 Bacteria 5888
48 Ga0213875_10027322 3300021388 Bacteria 2715
49 Ga0207695_10084129 3300025913 Bacteria 3212
50 Ga0207671_10066613 3300025914 Bacteria 2681
51 Ga0207660_10004341 3300025917 Bacteria 9241
52 Ga0207660_10137804 3300025917 Bacteria 1863
53 Ga0207657_10021252 3300025919 Bacteria 6113
54 Ga0207644_10010761 3300025931 Bacteria 6035
55 Ga0207690_10026146 3300025932 Bacteria 3674
56 Ga0207706_10250003 3300025933 Bacteria 1549
57 Ga0207670_10026077 3300025936 Bacteria 3679
58 Ga0207661_10000032 3300025944 Bacteria 158758
59 Ga0207661_10038055 3300025944 Bacteria 3768
60 Ga0207667_10008904 3300025949 Bacteria 11875
61 Ga0207667_10025324 3300025949 Bacteria 6496
62 Ga0207667_10056489 3300025949 Bacteria 4124
63 Ga0207667_10194506 3300025949 Bacteria 2081
64 Ga0207641_10114944 3300026088 Bacteria 2392
65 Ga0207641_10269930 3300026088 Bacteria 1596
66 Ga0207683_10119468 3300026121 Bacteria 2365
67 Ga0207428_10021978 3300027907 Bacteria 5390
68 Ga0207428_10193972 3300027907 Bacteria 1530
69 Ga0265316_10009951 3300031344 Bacteria 8709
70 Ga0265316_10085710 3300031344 Bacteria 2409
71 Ga0265316_10191552 3300031344 Unclassified 1519
72 Ga0373934_0032887 3300035086 Bacteria 2036
73 Ga0373954_0062746 3300035118 Bacteria 1756
74 Ga0373927_0001822 3300035695 Bacteria 15836
75 Ga0373927_0002500 3300035695 Bacteria 13415
76 Ga0373927_0046119 3300035695 Bacteria 2820
77 Ga0373933_0155408 3300035724 Bacteria 1450
78 Ga0373947_0000161 3300035725 Bacteria 35815
79 Ga0373937_0331144 3300036401 Unclassified 1441
80 Ga0373937_0400847 3300036401 Bacteria 1302
81 Ga0373925_0000188 3300037068 Bacteria 67960
82 Ga0436364_0225954 3300037853 Bacteria 33671
83 Ga0436364_0519372 3300037853 Bacteria 7798
84 Ga0436364_0768567 3300037853 Unclassified 2595
85 Ga0436364_0869241 3300037853 Unclassified 2829
86 Ga0436364_1004087 3300037853 Unclassified 2095
87 Ga0436364_1026069 3300037853 Unclassified 2596
88 Ga0436365_0030966 3300039437 Bacteria 1733
89 Ga0436365_0240979 3300039437 Bacteria 2780
90 Ga0436365_1073015 3300039437 Bacteria 4628
91 Ga0436365_1480261 3300039437 Bacteria 2862
92 Ga0436360_0008774 3300039438 Bacteria 1821
93 Ga0436361_0454518 3300039447 Bacteria 30587
94 Ga0436363_1401341 3300039450 Bacteria 3225
95 Ga0436362_0706363 3300039453 Bacteria 2686
96 Ga0453684_0104255 3300044712 Bacteria 3463
97 Ga0453684_0144662 3300044712 Bacteria 2834
98 Ga0451576_0029030 3300045051 Bacteria 5921
99 Ga0451576_0068037 3300045051 Bacteria 3707
100 Ga0495592_0055077 3300046454 Bacteria 2943
101 Ga0495603_0122926 3300046455 Bacteria 1512
102 Ga0495651_0028031 3300046462 Bacteria 4390
103 Ga0495580_0004436 3300046472 Bacteria 11792
104 Ga0495580_0020045 3300046472 Bacteria 4957
105 Ga0495580_0142231 3300046472 Bacteria 1663
106 Ga0495662_0016640 3300046476 Bacteria 3563
107 Ga0495618_0145694 3300046514 Bacteria 1514
108 Ga0495618_0212003 3300046514 Unclassified 1224
109 Ga0495628_0033473 3300046516 Bacteria 4142
110 Ga0495628_0056485 3300046516 Bacteria 3089
111 Ga0495630_0126608 3300046517 Unclassified 1939
112 Ga0495640_0075208 3300046533 Bacteria 2256
113 Ga0495586_0118316 3300046535 Bacteria 1479
114 Ga0495645_0003677 3300046543 Bacteria 10421
115 Ga0495645_0044337 3300046543 Bacteria 3245
116 Ga0495667_0004331 3300046559 Bacteria 9578
117 Ga0495635_0133762 3300046663 Bacteria 1690
118 Ga0495635_0224203 3300046663 Unclassified 1271
119 Ga0495599_0006941 3300046678 Bacteria 6848
120 Ga0495623_0013569 3300046679 Bacteria 5281
121 Ga0495613_0062620 3300046689 Bacteria 2722
122 Ga0495600_0017146 3300046809 Bacteria 4605
123 Ga0495600_0130607 3300046809 Unclassified 1633
124 Ga0495674_0011276 3300047319 Bacteria 8438
125 Ga0495674_0017513 3300047319 Bacteria 6669
126 Ga0495674_0065871 3300047319 Bacteria 3145
127 Ga0495674_0102190 3300047319 Bacteria 2438
128 Ga0495680_0113239 3300047322 Bacteria 2009
129 Ga0495680_0228413 3300047322 Unclassified 1326
130 Ga0495684_0010514 3300047471 Bacteria 7156
131 Ga0495684_0052315 3300047471 Bacteria 3117
132 Ga0495602_0037891 3300048088 Bacteria 4465
133 Ga0496109_0434559 3300048912 Unclassified 1240
134 Ga0496115_0072163 3300048918 Bacteria 2801
135 Ga0496115_0182516 3300048918 Bacteria 1734
136 Ga0501033_0003322 3300049570 Bacteria 13284
137 Ga0501033_0038804 3300049570 Bacteria 3558
138 Ga0501034_0051417 3300049571 Bacteria 4154
139 Ga0501036_0000610 3300049572 Bacteria 25955
140 Ga0501037_0014352 3300049573 Bacteria 5833
141 Ga0501037_0192877 3300049573 Bacteria 1442
142 Ga0501038_0128863 3300049574 Bacteria 2080
143 Ga0501038_0140802 3300049574 Bacteria 1973
144 Ga0501039_0006388 3300049575 Bacteria 8955
145 Ga0501043_0001659 3300049579 Bacteria 19308
146 Ga0501046_0007446 3300049580 Bacteria 9621
147 Ga0501047_0021974 3300049581 Bacteria 6127
148 Ga0501047_0179874 3300049581 Bacteria 1981
149 Ga0501067_0029684 3300049583 Bacteria 3030
150 Ga0501068_0000105 3300049584 Bacteria 36022
151 Ga0501069_0003791 3300049585 Bacteria 7778
152 Ga0501070_0134733 3300049586 Bacteria 2039
153 Ga0501072_0000213 3300049588 Bacteria 42312
154 Ga0501073_0005753 3300049589 Bacteria 9269
155 Ga0501074_0012425 3300049590 Bacteria 6189
156 Ga0501076_0007103 3300049592 Bacteria 8137
157 Ga0501077_0021842 3300049593 Bacteria 4052
158 Ga0501079_0032883 3300049741 Bacteria 3989
159 Ga0501080_0000068 3300049742 Bacteria 68760
160 Ga0501083_0030049 3300049744 Bacteria 3733
161 Ga0501044_0021232 3300049823 Bacteria 6931
162 Ga0501044_0025105 3300049823 Bacteria 6320
163 nmdc:mga05p37_81473_c1 3300050507 Bacteria 3986
164 nmdc:mga08y16_141478_c1 3300050511 Unclassified 2501
165 nmdc:mga08y16_2041_c1 3300050511 Bacteria 20696
166 nmdc:mga08x19_124553_c1 3300050514 Bacteria 1730
167 nmdc:mga08x19_504_c1 3300050514 Bacteria 25890
168 Ga0500604_0018448 3300053151 Unclassified 1944
169 Ga0501084_0000365 3300054114 Bacteria 34541
170 Ga0590074_000319 3300059423 Bacteria 6646
171 Ga0590075_000041 3300059424 Bacteria 33435
172 Ga0590077_001327 3300059426 Bacteria 5844
173 Ga0501082_0004761 3300060353 Bacteria 11839
174 Ga0207695_10006097
175 Ga0070683_100000014
176 Ga0070683_100045282
177 Ga0070680_100177181
178 Ga0070660_100034631
179 Ga0070689_100028908
180 Ga0070671_100045302
181 Ga0070708_100112012
182 Ga0070699_100098273
183 Ga0070684_100000004
184 Ga0070684_100083296
185 Ga0070695_100004811
186 Ga0068855_100012210
187 Ga0068863_100147459
188 Ga0070717_10010888
189 Ga0070717_10019396
190 Ga0070717_10119096
191 Ga0075428_100083673
192 Ga0075431_100015410
193 Ga0075436_100006434
194 Ga0075436_100040324
195 Ga0105240_10002280
196 Ga0105240_10020167
197 Ga0105240_10041513
198 Ga0111539_10009001
199 Ga0105241_10145478
200 Ga0105241_10189000
201 Ga0105248_10091512
202 Ga0105237_10065002
203 Ga0105249_10013537
204 Ga0157373_10062541
205 Ga0157370_10013216
206 Ga0157370_10175657
207 Ga0157369_10005023
208 Ga0157369_10013394
209 Ga0157369_10076438
210 Ga0157369_10077525
211 Ga0157374_10004176
212 Ga0157374_10005958
213 Ga0157372_10014702
214 Ga0157372_10100492
215 Ga0157372_10613462
216 Ga0163163_10068873
217 Ga0213872_10000310
218 Ga0213876_10001985
219 Ga0213875_10000010
220 Ga0213875_10006955
221 Ga0213875_10027322
222 Ga0207695_10084129
223 Ga0207671_10066613
224 Ga0207660_10004341
225 Ga0207660_10137804
226 Ga0207657_10021252
227 Ga0207644_10010761
228 Ga0207690_10026146
229 Ga0207706_10250003
230 Ga0207670_10026077
231 Ga0207661_10000032
232 Ga0207661_10038055
233 Ga0207667_10008904
234 Ga0207667_10025324
235 Ga0207667_10056489
236 Ga0207667_10194506
237 Ga0207641_10114944
238 Ga0207641_10269930
239 Ga0207683_10119468
240 Ga0207428_10021978
241 Ga0207428_10193972
242 Ga0265316_10009951
243 Ga0265316_10085710
244 Ga0265316_10191552
245 Ga0373934_0032887
246 Ga0373954_0062746
247 Ga0373927_0001822
248 Ga0373927_0002500
249 Ga0373927_0046119
250 Ga0373933_0155408
251 Ga0373947_0000161
252 Ga0373937_0331144
253 Ga0373937_0400847
254 Ga0373925_0000188
255 Ga0436364_0225954
256 Ga0436364_0519372
257 Ga0436364_0768567
258 Ga0436364_0869241
259 Ga0436364_1004087
260 Ga0436364_1026069
261 Ga0436365_0030966
262 Ga0436365_0240979
263 Ga0436365_1073015
264 Ga0436365_1480261
265 Ga0436360_0008774
266 Ga0436361_0454518
267 Ga0436363_1401341
268 Ga0436362_0706363
269 Ga0453684_0104255
270 Ga0453684_0144662
271 Ga0451576_0029030
272 Ga0451576_0068037
273 Ga0495592_0055077
274 Ga0495603_0122926
275 Ga0495651_0028031
276 Ga0495580_0004436
277 Ga0495580_0020045
278 Ga0495580_0142231
279 Ga0495662_0016640
280 Ga0495618_0145694
281 Ga0495618_0212003
282 Ga0495628_0033473
283 Ga0495628_0056485
284 Ga0495630_0126608
285 Ga0495640_0075208
286 Ga0495586_0118316
287 Ga0495645_0003677
288 Ga0495645_0044337
289 Ga0495667_0004331
290 Ga0495635_0133762
291 Ga0495635_0224203
292 Ga0495599_0006941
293 Ga0495623_0013569
294 Ga0495613_0062620
295 Ga0495600_0017146
296 Ga0495600_0130607
297 Ga0495674_0011276
298 Ga0495674_0017513
299 Ga0495674_0065871
300 Ga0495674_0102190
301 Ga0495680_0113239
302 Ga0495680_0228413
303 Ga0495684_0010514
304 Ga0495684_0052315
305 Ga0495602_0037891
306 Ga0496109_0434559
307 Ga0496115_0072163
308 Ga0496115_0182516
309 Ga0501033_0003322
310 Ga0501033_0038804
311 Ga0501034_0051417
312 Ga0501036_0000610
313 Ga0501037_0014352
314 Ga0501037_0192877
315 Ga0501038_0128863
316 Ga0501038_0140802
317 Ga0501039_0006388
318 Ga0501043_0001659
319 Ga0501046_0007446
320 Ga0501047_0021974
321 Ga0501047_0179874
322 Ga0501067_0029684
323 Ga0501068_0000105
324 Ga0501069_0003791
325 Ga0501070_0134733
326 Ga0501072_0000213
327 Ga0501073_0005753
328 Ga0501074_0012425
329 Ga0501076_0007103
330 Ga0501077_0021842
331 Ga0501079_0032883
332 Ga0501080_0000068
333 Ga0501083_0030049
334 Ga0501044_0021232
335 Ga0501044_0025105
336 nmdc:mga05p37_81473_c1
337 nmdc:mga08y16_141478_c1
338 nmdc:mga08y16_2041_c1
339 nmdc:mga08x19_124553_c1
340 nmdc:mga08x19_504_c1
341 Ga0500604_0018448
342 Ga0501084_0000365
343 Ga0590074_000319
344 Ga0590075_000041
345 Ga0590077_001327
346 Ga0501082_0004761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

77

198

0.93

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

258

408

0.82

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

258

362

0.81

PF19051

GFO_IDH_MocA_C2

Oxidoreductase family, C-terminal alpha/beta domain

216

444

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bvj-assembly4.cif.gz_D udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.863 30 383
2glx-assembly1.cif.gz_A crystal structure analysis of bacterial 1,5-af reductase 0.86 32 390
7bvj-assembly3.cif.gz_C udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8574 32 383
7bvk-assembly2.cif.gz_B udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p212121) 0.855 32 383
7bvj-assembly1.cif.gz_A udp-n-acetylglucosamine 3-dehydrogenase gnna from acidithiobacillus ferrooxidans (p21) 0.8485 32 383
ID Description Score Start End Superfamily
af_P42599_1_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9304 31 165 3.40.50.720
3e18B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9238 30 150 3.40.50.720
af_Q2G1E6_2_122_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9233 31 148 3.40.50.720
3db2C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9188 29 151 3.40.50.720
af_I1MZG8_3_134_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9188 27 151 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A416RGB7-F1-model_v4 deleted 0.9503 29 155
AF-A0A151BEY2-F1-model_v4 Gfo/Idh/MocA-like oxidoreductase N-terminal domain-containing protein 0.9349 29 176 GO:0000166
AF-A0A536UNG7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9328 29 151 GO:0000166
AF-A0A257WA22-F1-model_v4 Acetylgalactosaminidase 0.931 29 150 GO:0000166
GO:0016787
AF-A0A836SQT7-F1-model_v4 Gfo/Idh/MocA family oxidoreductase 0.9288 27 177 GO:0000166

Map