F261695

General Info

Members Datasets Scaffolds Average Seq Length
172 134 344 303

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2827628540|2827633238
Length 329
Sequence YGRCAPGRRLRAGPAAEFADHSLVWDAGRVHPLLKYSLGTAAGAVAAGAACVTYAAAYEAHAFRLRRFDVPVLAPGSRPLRILHLSDLHLMPDQQDKVDWVRGLAALEPDLVVNTGDNISDPESIPVALHAYERLLELPGVFVFGSNDYYAPSPVNPFRYLRRKEGPRPLVAPKLPIEDLRRGFTEAGWLDLNNAKGELKADGRRWAFAGVDDPHIRVDRYSEVAGPADESAELTIGVTHAPYRRVLDAMTADGYRLLLAGHTHGGQLALPLYGALVTNCDLDRGRAKGLSRWGLSWLHVSAGLGTSPYARIRFACYPEASLLTLRPAR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
52 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
53 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
54 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
55 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
61 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
65 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
66 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
84 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
85 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
116 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
117 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
118 2619619003 Frankia sp. CpI1-P Isolate Nodule
119 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
120 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
121 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
122 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
123 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
124 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
125 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
126 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
127 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
128 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
129 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
130 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
131 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
132 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
133 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
134 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.79
Metatranscriptomes 0.58
Isolates 11.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 1.74
Rhizoplane 6.4
Rhizosphere 83.14
Stem 0
Stem Tuber 0.58
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10002296 3300003203 Bacteria 9022
2 Ga0070658_10019716 3300005327 Bacteria 5400
3 Ga0070683_100459202 3300005329 Bacteria 1215
4 Ga0070683_100553919 3300005329 Bacteria 1099
5 Ga0070670_100395406 3300005331 Bacteria 1220
6 Ga0070660_100162781 3300005339 Bacteria 1798
7 Ga0070668_100031519 3300005347 Bacteria 4034
8 Ga0070668_100033708 3300005347 Bacteria 3901
9 Ga0070668_100202892 3300005347 Bacteria 1628
10 Ga0070659_100302764 3300005366 Bacteria 1334
11 Ga0070667_100221929 3300005367 Bacteria 1682
12 Ga0070663_100000503 3300005455 Bacteria 20668
13 Ga0070679_100270192 3300005530 Bacteria 1654
14 Ga0068855_100175792 3300005563 Bacteria 2423
15 Ga0070664_100302173 3300005564 Bacteria 1446
16 Ga0068857_100041612 3300005577 Bacteria 4075
17 Ga0068859_100014077 3300005617 Bacteria 8022
18 Ga0068858_100000001 3300005842 Bacteria 417735
19 Ga0068858_100015017 3300005842 Bacteria 7286
20 Ga0081455_10007072 3300005937 Bacteria 11912
21 Ga0081455_10101767 3300005937 Bacteria 2305
22 Ga0081455_10255007 3300005937 Bacteria 1281
23 Ga0081538_10001711 3300005981 Bacteria 22362
24 Ga0081540_1003683 3300005983 Bacteria 12016
25 Ga0081539_10000451 3300005985 Bacteria 87519
26 Ga0075428_100023663 3300006844 Bacteria 6799
27 Ga0075431_100020508 3300006847 Bacteria 6753
28 Ga0105248_10001012 3300009177 Bacteria 31032
29 Ga0157369_10104438 3300013105 Bacteria 3017
30 Ga0157372_10254455 3300013307 Bacteria 2039
31 Ga0157375_10286177 3300013308 Bacteria 1811
32 Ga0163163_10011570 3300014325 Bacteria 8014
33 Ga0157379_10000010 3300014968 Bacteria 124601
34 Ga0206353_11658394 3300020082 Bacteria 2377
35 Ga0207710_10000040 3300025900 Bacteria 229443
36 Ga0207649_10169507 3300025920 Bacteria 1519
37 Ga0207652_10142907 3300025921 Bacteria 2140
38 Ga0207694_10237518 3300025924 Bacteria 1489
39 Ga0207650_10149949 3300025925 Bacteria 1839
40 Ga0207700_10230253 3300025928 Bacteria 1575
41 Ga0207664_10340624 3300025929 Bacteria 1326
42 Ga0207690_10112618 3300025932 Bacteria 1962
43 Ga0207709_10188853 3300025935 Bacteria 1462
44 Ga0207711_10000844 3300025941 Bacteria 29618
45 Ga0207661_10235484 3300025944 Bacteria 1623
46 Ga0207668_10008301 3300025972 Bacteria 6186
47 Ga0207668_10022604 3300025972 Bacteria 4029
48 Ga0207668_10023691 3300025972 Bacteria 3951
49 Ga0207658_10088700 3300025986 Bacteria 2392
50 Ga0207677_10243893 3300026023 Bacteria 1455
51 Ga0207703_10000007 3300026035 Bacteria 418220
52 Ga0207678_10000054 3300026067 Bacteria 87616
53 Ga0207674_10094106 3300026116 Bacteria 2983
54 Ga0207674_10144171 3300026116 Bacteria 2341
55 Ga0207674_10239375 3300026116 Bacteria 1762
56 Ga0268264_10235788 3300028381 Bacteria 1692
57 Ga0307515_10032275 3300028794 Bacteria 8683
58 Ga0265327_10056472 3300031251 Bacteria 2023
59 Ga0307513_10267171 3300031456 Bacteria 1496
60 Ga0307518_10000115 3300031838 Bacteria 56725
61 Ga0307410_10002290 3300031852 Bacteria 9186
62 Ga0307410_10044374 3300031852 Bacteria 2953
63 Ga0307410_10340887 3300031852 Bacteria 1195
64 Ga0307412_10382543 3300031911 Bacteria 1140
65 Ga0307409_100045312 3300031995 Bacteria 3319
66 Ga0307409_100191107 3300031995 Bacteria 1822
67 Ga0307409_100406055 3300031995 Bacteria 1302
68 Ga0307409_100469214 3300031995 Bacteria 1219
69 Ga0307416_100053632 3300032002 Bacteria 3236
70 Ga0307416_100648395 3300032002 Bacteria 1140
71 Ga0307411_10388167 3300032005 Bacteria 1150
72 Ga0307415_100103137 3300032126 Bacteria 2097
73 Ga0307507_10183434 3300033179 Bacteria 1490
74 Ga0307510_10177846 3300033180 Bacteria 1695
75 Ga0307510_10280170 3300033180 Bacteria 1138
76 Ga0373956_0022457 3300035119 Bacteria 2700
77 Ga0373942_0002777 3300035207 Bacteria 4172
78 Ga0373935_0015417 3300035692 Bacteria 4620
79 Ga0395900_0015338 3300037418 Bacteria 7810
80 Ga0395898_0033122 3300037466 Bacteria 5158
81 Ga0395898_0224862 3300037466 Bacteria 1790
82 Ga0395898_0474740 3300037466 Bacteria 1190
83 Ga0395901_0002216 3300038443 Bacteria 19823
84 Ga0451839_0035564 3300041496 Bacteria 6938
85 Ga0439459_0031204 3300042438 Bacteria 1085
86 Ga0466969_0039592 3300044656 Bacteria 2366
87 Ga0466972_0005208 3300044658 Bacteria 6508
88 Ga0466965_0189557 3300044683 Bacteria 1087
89 Ga0466966_0018316 3300044684 Bacteria 4619
90 Ga0466966_0079545 3300044684 Bacteria 2043
91 Ga0466961_0050908 3300044693 Bacteria 2645
92 Ga0466963_0122277 3300044694 Bacteria 1792
93 Ga0466964_0161424 3300044706 Bacteria 1048
94 Ga0466968_0055329 3300044735 Bacteria 1702
95 Ga0466970_0029721 3300044765 Bacteria 2879
96 Ga0466970_0130837 3300044765 Bacteria 1378
97 Ga0466957_0058899 3300044842 Bacteria 2353
98 Ga0466957_0091183 3300044842 Bacteria 1910
99 Ga0466960_0008062 3300044901 Bacteria 4301
100 Ga0466960_0010716 3300044901 Bacteria 3814
101 Ga0466960_0066368 3300044901 Bacteria 1784
102 Ga0466960_0094833 3300044901 Bacteria 1527
103 Ga0466959_0015017 3300045049 Bacteria 5643
104 Ga0466959_0080013 3300045049 Bacteria 2356
105 Ga0466958_0075505 3300045836 Bacteria 2067
106 Ga0466958_0172237 3300045836 Bacteria 1371
107 Ga0466967_0005568 3300045976 Bacteria 8752
108 Ga0466967_0008797 3300045976 Bacteria 7441
109 Ga0466967_0009961 3300045976 Bacteria 7093
110 Ga0466967_0206509 3300045976 Bacteria 1862
111 Ga0466967_0413504 3300045976 Bacteria 1314
112 Ga0466967_0518306 3300045976 Bacteria 1171
113 Ga0495650_0054870 3300046471 Bacteria 1624
114 Ga0495606_0000899 3300046507 Bacteria 44298
115 Ga0495621_0118610 3300046539 Bacteria 1021
116 Ga0495656_0007054 3300046615 Bacteria 3960
117 Ga0495668_0000896 3300046616 Bacteria 33519
118 Ga0495625_0006564 3300046660 Bacteria 10330
119 Ga0495626_0000500 3300048091 Bacteria 39362
120 Ga0496100_0365184 3300048903 Bacteria 1093
121 Ga0496102_0493164 3300048905 Bacteria 1147
122 Ga0496103_0183632 3300048906 Bacteria 1344
123 Ga0496106_0022777 3300048909 Bacteria 4653
124 Ga0496108_0199500 3300048911 Bacteria 1736
125 Ga0496108_0212735 3300048911 Bacteria 1678
126 Ga0496109_0603552 3300048912 Bacteria 1034
127 Ga0496110_0116181 3300048913 Bacteria 2409
128 Ga0496111_0250218 3300048914 Bacteria 1315
129 Ga0496112_0055278 3300048915 Bacteria 3903
130 Ga0496114_0343750 3300048917 Bacteria 1319
131 Ga0501031_0151976 3300049568 Bacteria 1513
132 Ga0501036_0013959 3300049572 Bacteria 6679
133 Ga0501037_0109410 3300049573 Bacteria 1991
134 Ga0501038_0027528 3300049574 Bacteria 5057
135 Ga0501038_0361607 3300049574 Bacteria 1128
136 Ga0501039_0250985 3300049575 Bacteria 1391
137 Ga0501043_0148535 3300049579 Bacteria 1834
138 Ga0501043_0290580 3300049579 Bacteria 1251
139 Ga0501046_0036674 3300049580 Bacteria 3945
140 Ga0501047_0050666 3300049581 Bacteria 4009
141 Ga0501069_0200686 3300049585 Bacteria 1156
142 Ga0501073_0130283 3300049589 Bacteria 1743
143 Ga0501074_0091978 3300049590 Bacteria 2172
144 Ga0501074_0123797 3300049590 Bacteria 1849
145 Ga0501044_0174082 3300049823 Bacteria 2122
146 nmdc:mga0qj67_137811_c1 3300050509 Bacteria 1977
147 nmdc:mga0qj67_327_c1 3300050509 Bacteria 32750
148 nmdc:mga06r32_35401_c1 3300050510 Bacteria 4711
149 Ga0500616_0068155 3300053153 Bacteria 1823
150 Ga0501084_0103360 3300054114 Bacteria 2393
151 Ga0501084_0212620 3300054114 Bacteria 1632
152 Ga0466962_0048632 3300061719 Bacteria 2026
153 2827633238 2827628540 Bacteria 6858585
154 2515855475 2515154155 Bacteria 7985436
155 2586065233 2585427649 Bacteria 9053857
156 2620353682 2619619003 Bacteria 7619552
157 2623499379 2622736605 Bacteria 4992138
158 2676474293 2675903058 Bacteria 6822861
159 2753075214 2751185734 Bacteria 8863695
160 2809593628 2808606522 Bacteria 9488490
161 2816422718 2816332119 Bacteria 8120218
162 2837274387 2837268691 Bacteria 7850704
163 2870728474 2870721527 Bacteria 9689237
164 2887485629 2887478801 Bacteria 8972725
165 2899373013 2899370129 Bacteria 6781179
166 2915773737 2915768154 Bacteria 8424322
167 2917743851 2917736166 Bacteria 9690793
168 8001783036 8001781756 Bacteria 9586736
169 8003315271 8003314358 Bacteria 10575343
170 8047718859 8047710418 Bacteria 11023148
171 8054917397 8054913762 Bacteria 7713009
172 8054925781 8054920844 Bacteria 7068637
173 JGI25406J46586_10002296
174 Ga0070658_10019716
175 Ga0070683_100459202
176 Ga0070683_100553919
177 Ga0070670_100395406
178 Ga0070660_100162781
179 Ga0070668_100031519
180 Ga0070668_100033708
181 Ga0070668_100202892
182 Ga0070659_100302764
183 Ga0070667_100221929
184 Ga0070663_100000503
185 Ga0070679_100270192
186 Ga0068855_100175792
187 Ga0070664_100302173
188 Ga0068857_100041612
189 Ga0068859_100014077
190 Ga0068858_100000001
191 Ga0068858_100015017
192 Ga0081455_10007072
193 Ga0081455_10101767
194 Ga0081455_10255007
195 Ga0081538_10001711
196 Ga0081540_1003683
197 Ga0081539_10000451
198 Ga0075428_100023663
199 Ga0075431_100020508
200 Ga0105248_10001012
201 Ga0157369_10104438
202 Ga0157372_10254455
203 Ga0157375_10286177
204 Ga0163163_10011570
205 Ga0157379_10000010
206 Ga0206353_11658394
207 Ga0207710_10000040
208 Ga0207649_10169507
209 Ga0207652_10142907
210 Ga0207694_10237518
211 Ga0207650_10149949
212 Ga0207700_10230253
213 Ga0207664_10340624
214 Ga0207690_10112618
215 Ga0207709_10188853
216 Ga0207711_10000844
217 Ga0207661_10235484
218 Ga0207668_10008301
219 Ga0207668_10022604
220 Ga0207668_10023691
221 Ga0207658_10088700
222 Ga0207677_10243893
223 Ga0207703_10000007
224 Ga0207678_10000054
225 Ga0207674_10094106
226 Ga0207674_10144171
227 Ga0207674_10239375
228 Ga0268264_10235788
229 Ga0307515_10032275
230 Ga0265327_10056472
231 Ga0307513_10267171
232 Ga0307518_10000115
233 Ga0307410_10002290
234 Ga0307410_10044374
235 Ga0307410_10340887
236 Ga0307412_10382543
237 Ga0307409_100045312
238 Ga0307409_100191107
239 Ga0307409_100406055
240 Ga0307409_100469214
241 Ga0307416_100053632
242 Ga0307416_100648395
243 Ga0307411_10388167
244 Ga0307415_100103137
245 Ga0307507_10183434
246 Ga0307510_10177846
247 Ga0307510_10280170
248 Ga0373956_0022457
249 Ga0373942_0002777
250 Ga0373935_0015417
251 Ga0395900_0015338
252 Ga0395898_0033122
253 Ga0395898_0224862
254 Ga0395898_0474740
255 Ga0395901_0002216
256 Ga0451839_0035564
257 Ga0439459_0031204
258 Ga0466969_0039592
259 Ga0466972_0005208
260 Ga0466965_0189557
261 Ga0466966_0018316
262 Ga0466966_0079545
263 Ga0466961_0050908
264 Ga0466963_0122277
265 Ga0466964_0161424
266 Ga0466968_0055329
267 Ga0466970_0029721
268 Ga0466970_0130837
269 Ga0466957_0058899
270 Ga0466957_0091183
271 Ga0466960_0008062
272 Ga0466960_0010716
273 Ga0466960_0066368
274 Ga0466960_0094833
275 Ga0466959_0015017
276 Ga0466959_0080013
277 Ga0466958_0075505
278 Ga0466958_0172237
279 Ga0466967_0005568
280 Ga0466967_0008797
281 Ga0466967_0009961
282 Ga0466967_0206509
283 Ga0466967_0413504
284 Ga0466967_0518306
285 Ga0495650_0054870
286 Ga0495606_0000899
287 Ga0495621_0118610
288 Ga0495656_0007054
289 Ga0495668_0000896
290 Ga0495625_0006564
291 Ga0495626_0000500
292 Ga0496100_0365184
293 Ga0496102_0493164
294 Ga0496103_0183632
295 Ga0496106_0022777
296 Ga0496108_0199500
297 Ga0496108_0212735
298 Ga0496109_0603552
299 Ga0496110_0116181
300 Ga0496111_0250218
301 Ga0496112_0055278
302 Ga0496114_0343750
303 Ga0501031_0151976
304 Ga0501036_0013959
305 Ga0501037_0109410
306 Ga0501038_0027528
307 Ga0501038_0361607
308 Ga0501039_0250985
309 Ga0501043_0148535
310 Ga0501043_0290580
311 Ga0501046_0036674
312 Ga0501047_0050666
313 Ga0501069_0200686
314 Ga0501073_0130283
315 Ga0501074_0091978
316 Ga0501074_0123797
317 Ga0501044_0174082
318 nmdc:mga0qj67_137811_c1
319 nmdc:mga0qj67_327_c1
320 nmdc:mga06r32_35401_c1
321 Ga0500616_0068155
322 Ga0501084_0103360
323 Ga0501084_0212620
324 Ga0466962_0048632
325 2827633238
326 2515855475
327 2586065233
328 2620353682
329 2623499379
330 2676474293
331 2753075214
332 2809593628
333 2816422718
334 2837274387
335 2870728474
336 2887485629
337 2899373013
338 2915773737
339 2917743851
340 8001783036
341 8003315271
342 8047718859
343 8054917397
344 8054925781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

80

266

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x3z-assembly1.cif.gz_A inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp and nad 0.6938 199 235
5uqh-assembly1.cif.gz_C crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.6695 197 234
5uqh-assembly1.cif.gz_B crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p182 0.6538 198 235
5f3w-assembly1.cif.gz_C structure of the atprs-mre11/rad50-dna complex 0.626 49 279
3av0-assembly1.cif.gz_A crystal structure of mre11-rad50 bound to atp s 0.6181 46 276
ID Description Score Start End Superfamily
af_I6X827_50_260_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9533 49 259 3.60.21.10
af_I6X827_50_260_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9358 49 259 3.60.21.10
af_P37049_48_231_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.769 49 254 3.60.21.10
af_P37049_48_231_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7621 49 254 3.60.21.10
af_Q54PY8_309_517_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7256 49 275 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A838WVL8-F1-model_v4 Metallophosphoesterase 0.98 46 111 GO:0016787
AF-M3TC68-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9755 3 300 GO:0008758
GO:0009245
GO:0016020
AF-G7GN54-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.975 1 300 GO:0008758
GO:0009245
GO:0016020
AF-A0A349AYD1-F1-model_v4 Metallophosphoesterase 0.9744 52 112 GO:0016787
AF-U5EHX9-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9743 6 299 GO:0008758
GO:0009245
GO:0016020

Map