F261506

General Info

Members Datasets Scaffolds Average Seq Length
172 123 342 241

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0070570|Ga0501039_0070570_1060_1923
Length 287
Sequence VERVLSALDSAVLVLAVAETVQRPARPTAGRAQREVTVKNYDPVMSFGEDIAETYDDLQRFSKTPSRSDVAAAVAFLEKLAAGGPALELAIGTGWIALPLAARGVRVDGIDFSPAMVAQLRAKPGGEQIAVTIGDFAGVSVPGVYRLIFVVANTLFNLLTQDDQVRCFENVAAHLTDDGSFLIEAFHPAFLYRLRDHQYVDAEAVEIDEXXXXVARHDPVTQLLEESHVSLSRAGVRLNPIVTRYAWPSEMDLMARIAGLRLKERWAGWNREPYTAASSSLVSVYGR

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
69 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
75 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
81 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
96 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
99 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
100 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 15.12
Rhizosphere 84.3
Stem 0
Stem Tuber 0
Unclassified 13.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0070570 3300049575 Bacteria 2714
2 JGI25405J52794_10000886 3300003911 Bacteria 4675
3 Ga0070683_100100923 3300005329 Bacteria 2717
4 Ga0068868_100200619 3300005338 Bacteria 1663
5 Ga0070689_100024695 3300005340 Bacteria 4508
6 Ga0070687_100083817 3300005343 Bacteria 1746
7 Ga0070688_100362183 3300005365 Bacteria 1064
8 Ga0070714_100021854 3300005435 Bacteria 5238
9 Ga0070711_100025934 3300005439 Bacteria 3838
10 Ga0070694_100420420 3300005444 Bacteria 1050
11 Ga0070681_10194973 3300005458 Bacteria 1945
12 Ga0070685_10391639 3300005466 Bacteria 960
13 Ga0070706_100002833 3300005467 Bacteria 17325
14 Ga0070706_100078179 3300005467 Bacteria 3063
15 Ga0070698_100206016 3300005471 Bacteria 1902
16 Ga0070697_100075493 3300005536 Bacteria 2771
17 Ga0070686_100056592 3300005544 Bacteria 2516
18 Ga0070686_100210700 3300005544 Bacteria 1399
19 Ga0070686_100442037 3300005544 Bacteria 998
20 Ga0070696_100031556 3300005546 Bacteria 3632
21 Ga0070693_100170016 3300005547 Bacteria 1395
22 Ga0070693_100194392 3300005547 Bacteria 1314
23 Ga0070704_100514362 3300005549 Bacteria 1041
24 Ga0070664_100365933 3300005564 Bacteria 1314
25 Ga0081455_10000430 3300005937 Bacteria 55073
26 Ga0081538_10014626 3300005981 Bacteria 6135
27 Ga0081538_10040135 3300005981 Bacteria 2990
28 Ga0081539_10028249 3300005985 Bacteria 3531
29 Ga0070717_10001761 3300006028 Bacteria 15078
30 Ga0070717_10211106 3300006028 Bacteria 1704
31 Ga0097621_100383798 3300006237 Bacteria 1255
32 Ga0075428_100004111 3300006844 Bacteria 16016
33 Ga0075428_100019562 3300006844 Bacteria 7492
34 Ga0075428_100331598 3300006844 Bacteria 1634
35 Ga0075430_100232897 3300006846 Bacteria 1527
36 Ga0075431_100713880 3300006847 Bacteria 980
37 Ga0075429_100004720 3300006880 Bacteria 11730
38 Ga0068865_100463646 3300006881 Bacteria 1050
39 Ga0111539_10474060 3300009094 Bacteria 1457
40 Ga0111539_10518458 3300009094 Unclassified 1389
41 Ga0111539_10819587 3300009094 Bacteria 1083
42 Ga0114129_10064455 3300009147 Bacteria 5114
43 Ga0105243_10064906 3300009148 Unclassified 2931
44 Ga0105243_10139356 3300009148 Bacteria 2067
45 Ga0105248_10259598 3300009177 Unclassified 1956
46 Ga0105249_10148263 3300009553 Unclassified 2256
47 Ga0105239_10265406 3300010375 Bacteria 1930
48 Ga0105246_10047485 3300011119 Bacteria 2932
49 Ga0105246_10276966 3300011119 Unclassified 1344
50 Ga0157374_10432351 3300013296 Bacteria 1316
51 Ga0163162_10052438 3300013306 Bacteria 4096
52 Ga0163162_10269481 3300013306 Bacteria 1834
53 Ga0157377_10289476 3300014745 Bacteria 1077
54 Ga0157376_10151772 3300014969 Bacteria 2090
55 Ga0207692_10014204 3300025898 Bacteria 3475
56 Ga0207642_10024952 3300025899 Unclassified 2411
57 Ga0207684_10002805 3300025910 Bacteria 17326
58 Ga0207684_10029903 3300025910 Bacteria 4637
59 Ga0207707_10158944 3300025912 Bacteria 1976
60 Ga0207693_10014106 3300025915 Bacteria 6434
61 Ga0207662_10134233 3300025918 Bacteria 1563
62 Ga0207646_10565509 3300025922 Bacteria 1022
63 Ga0207694_10368194 3300025924 Bacteria 1192
64 Ga0207687_10256159 3300025927 Bacteria 1393
65 Ga0207706_10142972 3300025933 Bacteria 2104
66 Ga0207709_10047188 3300025935 Bacteria 2617
67 Ga0207709_10121969 3300025935 Bacteria 1761
68 Ga0207691_10456664 3300025940 Bacteria 1087
69 Ga0207711_10464683 3300025941 Unclassified 1178
70 Ga0207668_10258481 3300025972 Bacteria 1418
71 Ga0207658_10224016 3300025986 Bacteria 1584
72 Ga0207658_10632361 3300025986 Unclassified 964
73 Ga0207677_10339924 3300026023 Bacteria 1254
74 Ga0207648_10312009 3300026089 Bacteria 1412
75 Ga0207648_10333150 3300026089 Bacteria 1365
76 Ga0207698_10463312 3300026142 Bacteria 1226
77 Ga0209971_1022838 3300027682 Unclassified 1491
78 Ga0209974_10072660 3300027876 Unclassified 1175
79 Ga0268266_10146347 3300028379 Bacteria 2125
80 Ga0268266_10603063 3300028379 Bacteria 1055
81 Ga0316579_10074637 3300031691 Bacteria 1610
82 Ga0316579_10175828 3300031691 Bacteria 1035
83 Ga0316576_10063420 3300031727 Bacteria 2712
84 Ga0316577_10095705 3300031733 Unclassified 1663
85 Ga0316577_10201896 3300031733 Unclassified 1123
86 Ga0307410_10113514 3300031852 Bacteria 1964
87 Ga0307406_10059327 3300031901 Bacteria 2463
88 Ga0307407_10011353 3300031903 Bacteria 4238
89 Ga0307409_100032880 3300031995 Bacteria 3767
90 Ga0307416_100079622 3300032002 Bacteria 2762
91 Ga0307416_100153102 3300032002 Bacteria 2118
92 Ga0307416_100449331 3300032002 Bacteria 1341
93 Ga0307416_100664257 3300032002 Bacteria 1128
94 Ga0307414_10079857 3300032004 Bacteria 2390
95 Ga0307414_10212480 3300032004 Bacteria 1582
96 Ga0307411_10169410 3300032005 Bacteria 1645
97 Ga0307415_100114031 3300032126 Bacteria 2011
98 Ga0316585_10051352 3300032137 Unclassified 1324
99 Ga0316596_1027670 3300033541 Unclassified 1464
100 Ga0316574_0418384 3300035398 Unclassified 842
101 Ga0373935_0378905 3300035692 Bacteria 1013
102 Ga0316582_0115128 3300036647 Bacteria 1794
103 Ga0316582_0204572 3300036647 Unclassified 1347
104 Ga0316584_0006198 3300036712 Bacteria 8094
105 Ga0316584_0448983 3300036712 Unclassified 912
106 Ga0316584_0459074 3300036712 Bacteria 900
107 Ga0316581_0038012 3300037588 Bacteria 1463
108 Ga0453683_0000679 3300044673 Bacteria 36072
109 Ga0453683_0028943 3300044673 Bacteria 3505
110 Ga0466963_0454708 3300044694 Unclassified 904
111 Ga0453684_0001418 3300044712 Bacteria 69005
112 Ga0466960_0228349 3300044901 Bacteria 1027
113 Ga0466967_0011213 3300045976 Bacteria 6775
114 Ga0466967_0060343 3300045976 Bacteria 3360
115 Ga0466967_0436890 3300045976 Bacteria 1278
116 Ga0495629_0144323 3300046459 Bacteria 1656
117 Ga0495608_0060870 3300046511 Bacteria 2484
118 Ga0495666_0082995 3300046526 Bacteria 1515
119 Ga0495587_0105408 3300046536 Bacteria 1622
120 Ga0495667_0173021 3300046559 Bacteria 1387
121 Ga0495656_0188697 3300046615 Bacteria 1017
122 Ga0495600_0077425 3300046809 Bacteria 2172
123 Ga0495604_0343722 3300047317 Bacteria 993
124 Ga0495680_0094348 3300047322 Bacteria 2239
125 Ga0496100_0047210 3300048903 Bacteria 2773
126 Ga0496101_0006660 3300048904 Bacteria 7450
127 Ga0496101_0047940 3300048904 Bacteria 3068
128 Ga0496102_0013081 3300048905 Bacteria 7183
129 Ga0496102_0221343 3300048905 Bacteria 1784
130 Ga0496103_0107788 3300048906 Bacteria 1767
131 Ga0496103_0175950 3300048906 Unclassified 1375
132 Ga0496104_0033084 3300048907 Bacteria 4813
133 Ga0496104_0054337 3300048907 Bacteria 3785
134 Ga0496104_0509497 3300048907 Unclassified 1114
135 Ga0496105_0053656 3300048908 Bacteria 3329
136 Ga0496105_0079170 3300048908 Bacteria 2714
137 Ga0496106_0006640 3300048909 Bacteria 8566
138 Ga0496106_0256839 3300048909 Bacteria 1398
139 Ga0496107_0003072 3300048910 Bacteria 11076
140 Ga0496108_0056961 3300048911 Bacteria 3284
141 Ga0496109_0033043 3300048912 Bacteria 4654
142 Ga0496109_0552838 3300048912 Bacteria 1086
143 Ga0496111_0124032 3300048914 Unclassified 1909
144 Ga0496111_0593214 3300048914 Bacteria 811
145 Ga0496112_0000132 3300048915 Bacteria 46537
146 Ga0496112_0177553 3300048915 Bacteria 2094
147 Ga0496112_0442097 3300048915 Bacteria 1238
148 Ga0496112_0684150 3300048915 Bacteria 954
149 Ga0496114_0560425 3300048917 Bacteria 1009
150 Ga0496115_0176557 3300048918 Bacteria 1766
151 Ga0501034_0387816 3300049571 Bacteria 1321
152 Ga0501067_0130979 3300049583 Bacteria 1396
153 Ga0501073_0081142 3300049589 Bacteria 2256
154 Ga0501073_0527041 3300049589 Bacteria 816
155 Ga0501198_019853 3300049649 Bacteria 1062
156 Ga0501080_0176575 3300049742 Bacteria 1967
157 Ga0501044_0102887 3300049823 Bacteria 2871
158 nmdc:mga05p37_1140473_c1 3300050507 Bacteria 812
159 nmdc:mga05p37_150006_c1 3300050507 Bacteria 2852
160 nmdc:mga09592_353151_c1 3300050508 Bacteria 1272
161 nmdc:mga09592_56637_c1 3300050508 Bacteria 3312
162 nmdc:mga0qj67_92357_c1 3300050509 Bacteria 2433
163 nmdc:mga06r32_165472_c1 3300050510 Bacteria 2194
164 nmdc:mga06r32_349182_c1 3300050510 Unclassified 1464
165 nmdc:mga06r32_489503_c1 3300050510 Bacteria 1208
166 nmdc:mga08y16_31213_c1 3300050511 Bacteria 5606
167 Ga0495655_0110045 3300053083 Bacteria 827
168 Ga0500568_0050103 3300053139 Bacteria 1647
169 Ga0501082_0153298 3300060353 Bacteria 2002
170 Ga0501082_0467918 3300060353 Unclassified 1102
171 Ga0530510_0186369 3300061734 Bacteria 1540
172 Ga0501039_0070570
173 JGI25405J52794_10000886
174 Ga0070683_100100923
175 Ga0068868_100200619
176 Ga0070689_100024695
177 Ga0070687_100083817
178 Ga0070688_100362183
179 Ga0070714_100021854
180 Ga0070711_100025934
181 Ga0070694_100420420
182 Ga0070681_10194973
183 Ga0070685_10391639
184 Ga0070706_100002833
185 Ga0070706_100078179
186 Ga0070698_100206016
187 Ga0070697_100075493
188 Ga0070686_100056592
189 Ga0070686_100210700
190 Ga0070686_100442037
191 Ga0070696_100031556
192 Ga0070693_100170016
193 Ga0070693_100194392
194 Ga0070704_100514362
195 Ga0070664_100365933
196 Ga0081455_10000430
197 Ga0081538_10014626
198 Ga0081538_10040135
199 Ga0081539_10028249
200 Ga0070717_10001761
201 Ga0070717_10211106
202 Ga0097621_100383798
203 Ga0075428_100004111
204 Ga0075428_100019562
205 Ga0075428_100331598
206 Ga0075430_100232897
207 Ga0075431_100713880
208 Ga0075429_100004720
209 Ga0068865_100463646
210 Ga0111539_10474060
211 Ga0111539_10518458
212 Ga0111539_10819587
213 Ga0114129_10064455
214 Ga0105243_10064906
215 Ga0105243_10139356
216 Ga0105248_10259598
217 Ga0105249_10148263
218 Ga0105239_10265406
219 Ga0105246_10047485
220 Ga0105246_10276966
221 Ga0157374_10432351
222 Ga0163162_10052438
223 Ga0163162_10269481
224 Ga0157377_10289476
225 Ga0157376_10151772
226 Ga0207692_10014204
227 Ga0207642_10024952
228 Ga0207684_10002805
229 Ga0207684_10029903
230 Ga0207707_10158944
231 Ga0207693_10014106
232 Ga0207662_10134233
233 Ga0207646_10565509
234 Ga0207694_10368194
235 Ga0207687_10256159
236 Ga0207706_10142972
237 Ga0207709_10047188
238 Ga0207709_10121969
239 Ga0207691_10456664
240 Ga0207711_10464683
241 Ga0207668_10258481
242 Ga0207658_10224016
243 Ga0207658_10632361
244 Ga0207677_10339924
245 Ga0207648_10312009
246 Ga0207648_10333150
247 Ga0207698_10463312
248 Ga0209971_1022838
249 Ga0209974_10072660
250 Ga0268266_10146347
251 Ga0268266_10603063
252 Ga0316579_10074637
253 Ga0316579_10175828
254 Ga0316576_10063420
255 Ga0316577_10095705
256 Ga0316577_10201896
257 Ga0307410_10113514
258 Ga0307406_10059327
259 Ga0307407_10011353
260 Ga0307409_100032880
261 Ga0307416_100079622
262 Ga0307416_100153102
263 Ga0307416_100449331
264 Ga0307416_100664257
265 Ga0307414_10079857
266 Ga0307414_10212480
267 Ga0307411_10169410
268 Ga0307415_100114031
269 Ga0316585_10051352
270 Ga0316596_1027670
271 Ga0316574_0418384
272 Ga0373935_0378905
273 Ga0316582_0115128
274 Ga0316582_0204572
275 Ga0316584_0006198
276 Ga0316584_0448983
277 Ga0316584_0459074
278 Ga0316581_0038012
279 Ga0453683_0000679
280 Ga0453683_0028943
281 Ga0466963_0454708
282 Ga0453684_0001418
283 Ga0466960_0228349
284 Ga0466967_0011213
285 Ga0466967_0060343
286 Ga0466967_0436890
287 Ga0495629_0144323
288 Ga0495608_0060870
289 Ga0495666_0082995
290 Ga0495587_0105408
291 Ga0495667_0173021
292 Ga0495656_0188697
293 Ga0495600_0077425
294 Ga0495604_0343722
295 Ga0495680_0094348
296 Ga0496100_0047210
297 Ga0496101_0006660
298 Ga0496101_0047940
299 Ga0496102_0013081
300 Ga0496102_0221343
301 Ga0496103_0107788
302 Ga0496103_0175950
303 Ga0496104_0033084
304 Ga0496104_0054337
305 Ga0496104_0509497
306 Ga0496105_0053656
307 Ga0496105_0079170
308 Ga0496106_0006640
309 Ga0496106_0256839
310 Ga0496107_0003072
311 Ga0496108_0056961
312 Ga0496109_0033043
313 Ga0496109_0552838
314 Ga0496111_0124032
315 Ga0496111_0593214
316 Ga0496112_0000132
317 Ga0496112_0177553
318 Ga0496112_0442097
319 Ga0496112_0684150
320 Ga0496114_0560425
321 Ga0496115_0176557
322 Ga0501034_0387816
323 Ga0501067_0130979
324 Ga0501073_0081142
325 Ga0501073_0527041
326 Ga0501198_019853
327 Ga0501080_0176575
328 Ga0501044_0102887
329 nmdc:mga05p37_1140473_c1
330 nmdc:mga05p37_150006_c1
331 nmdc:mga09592_353151_c1
332 nmdc:mga09592_56637_c1
333 nmdc:mga0qj67_92357_c1
334 nmdc:mga06r32_165472_c1
335 nmdc:mga06r32_349182_c1
336 nmdc:mga06r32_489503_c1
337 nmdc:mga08y16_31213_c1
338 Ga0495655_0110045
339 Ga0500568_0050103
340 Ga0501082_0153298
341 Ga0501082_0467918
342 Ga0530510_0186369

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

86

179

0.88

PF08241

Methyltransf_11

Methyltransferase domain

87

183

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8877 1 228
4hh4-assembly1.cif.gz_C structure of the ccbj methyltransferase from streptomyces caelestis 0.8803 1 228
4hgy-assembly1.cif.gz_E structure of the ccbj methyltransferase from streptomyces caelestis 0.8769 19 228
7wzg-assembly1.cif.gz_F cypemycin n-terminal methyltransferase cypm 0.8643 28 229
7wzf-assembly1.cif.gz_A structural and mechanism analysis of yunm 0.8511 16 227
ID Description Score Start End Superfamily
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9226 25 228 3.40.50.150
4hgzB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8908 25 228 3.40.50.150
3d2lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8893 15 229 3.40.50.150
4hh4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.889 4 228 3.40.50.150
4hh4B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8711 4 228 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6A7MUL2-F1-model_v4 deleted 0.9753 1 132
AF-A0A0K2ZD92-F1-model_v4 Methyltransferase 0.9594 34 144 GO:0008168
GO:0032259
AF-A0A6A7MUL2-F1-model_v4 deleted 0.954 1 132
AF-A0A7V9PWJ8-F1-model_v4 Class I SAM-dependent methyltransferase 0.9298 43 227 GO:0008168
GO:0032259
AF-A0A7V9JP08-F1-model_v4 SAM-dependent methyltransferase 0.928 10 101 GO:0008757
GO:0032259

Map