F260839

General Info

Members Datasets Scaffolds Average Seq Length
172 97 344 390

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10005024|Ga0207693_100050249
Length 432
Sequence VSMSMLVASRSRIFRVFEAIEAMSCFAPADLDELRDAIGEALAVEEPLEVVAGGSKRGLGRPLQLPRMLDLSRLAGIRDYQSSELVLTAGAATPIEEIDAALAEAEQMLAFEPPDFGALFGLPVTIAGRRTLGGALACNLSGPRRIKAGAARDHFLGFRAVSGRGEVFKAGGKVVKNVTGYDLSKLMAGSFGTLAALEEVTVKVMPRPEALSTVMLWGLDASAAVRILSRALASPHDVSGAVYLPAPSTIGLISLSGSASVAALRLEGPHPSVMFRRERLLAELGSVSEASSLGDAASIAFWRAVRDVLPLAGSGDRAVWRVSVAPSRGGELAEAITRRHDTNWYLDWAGGLVWAAIAGAEDGGAAAIRNAIRGAGGRGTGHATLIKGSLELRRSVPVFEPQPPPLAALTGRIKEGFDPRRILNPGRMVEEF

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
60 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
92 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
93 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
94 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
95 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
96 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
97 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.09
Metatranscriptomes 0
Isolates 2.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.07
Nodule 0
Rhizoplane 8.72
Rhizosphere 74.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10005024 3300025915 Bacteria 11103
2 JGI25153J46596_10023451 3300003215 Bacteria 2249
3 Ga0055536_1028721 3300003781 Bacteria 1510
4 Ga0065165_1000649 3300005262 Bacteria 50230
5 Ga0070661_100000041 3300005344 Bacteria 99916
6 Ga0070709_10032456 3300005434 Bacteria 3149
7 Ga0070709_10064716 3300005434 Bacteria 2339
8 Ga0070709_10117917 3300005434 Bacteria 1794
9 Ga0070714_100057811 3300005435 Bacteria 3320
10 Ga0070714_100113073 3300005435 Bacteria 2407
11 Ga0070714_100245040 3300005435 Bacteria 1655
12 Ga0070713_100039023 3300005436 Bacteria 3851
13 Ga0070713_100172870 3300005436 Bacteria 1936
14 Ga0070710_10000812 3300005437 Bacteria 15011
15 Ga0070711_100003711 3300005439 Bacteria 8947
16 Ga0070711_100062781 3300005439 Bacteria 2590
17 Ga0070700_100086414 3300005441 Bacteria 2036
18 Ga0070708_100098453 3300005445 Bacteria 2674
19 Ga0070706_100066850 3300005467 Bacteria 3325
20 Ga0070707_100045842 3300005468 Bacteria 4184
21 Ga0070699_100028774 3300005518 Bacteria 4791
22 Ga0070665_100028417 3300005548 Bacteria 5632
23 Ga0068855_100047697 3300005563 Bacteria 5060
24 Ga0068856_100014419 3300005614 Bacteria 7637
25 Ga0068856_100112659 3300005614 Bacteria 2718
26 Ga0068856_100180894 3300005614 Bacteria 2121
27 Ga0068856_100347951 3300005614 Bacteria 1501
28 Ga0070717_10164367 3300006028 Bacteria 1927
29 Ga0070712_100000018 3300006175 Bacteria 102923
30 Ga0070712_100007223 3300006175 Bacteria 6929
31 Ga0070712_100042231 3300006175 Bacteria 3135
32 Ga0075370_10098048 3300006353 Bacteria 1695
33 Ga0099795_10000680 3300007788 Bacteria 6541
34 Ga0105240_10048227 3300009093 Bacteria 5385
35 Ga0105240_10097888 3300009093 Bacteria 3574
36 Ga0105240_10198840 3300009093 Bacteria 2351
37 Ga0105240_10305650 3300009093 Bacteria 1818
38 Ga0105241_10019391 3300009174 Bacteria 5015
39 Ga0105237_10006391 3300009545 Bacteria 13077
40 Ga0105237_10147762 3300009545 Bacteria 2346
41 Ga0105238_10000490 3300009551 Bacteria 41680
42 Ga0105238_10035495 3300009551 Bacteria 5068
43 Ga0105238_10045808 3300009551 Bacteria 4418
44 Ga0099796_10010825 3300010159 Bacteria 2522
45 Ga0105239_10275681 3300010375 Bacteria 1892
46 Ga0182008_10044994 3300014497 Bacteria 2194
47 Ga0213872_10000195 3300021361 Bacteria 53767
48 Ga0213872_10000649 3300021361 Bacteria 26344
49 Ga0213872_10005462 3300021361 Bacteria 6534
50 Ga0213872_10033885 3300021361 Bacteria 2339
51 Ga0213872_10036321 3300021361 Bacteria 2252
52 Ga0213874_10011310 3300021377 Bacteria 2257
53 Ga0213875_10000091 3300021388 Bacteria 104903
54 Ga0213875_10001018 3300021388 Bacteria 19861
55 Ga0213875_10006926 3300021388 Bacteria 5904
56 Ga0209026_1002061 3300025250 Bacteria 7917
57 Ga0209675_1001492 3300025291 Bacteria 13423
58 Ga0209676_1000026 3300025292 Bacteria 574599
59 Ga0207692_10026593 3300025898 Bacteria 2716
60 Ga0207699_10051117 3300025906 Bacteria 2441
61 Ga0207699_10105516 3300025906 Bacteria 1797
62 Ga0207684_10252588 3300025910 Bacteria 1521
63 Ga0207695_10005905 3300025913 Bacteria 16056
64 Ga0207695_10059509 3300025913 Bacteria 3961
65 Ga0207695_10163640 3300025913 Bacteria 2154
66 Ga0207695_10189422 3300025913 Bacteria 1975
67 Ga0207671_10148314 3300025914 Bacteria 1811
68 Ga0207693_10000145 3300025915 Bacteria 65383
69 Ga0207693_10083148 3300025915 Bacteria 2507
70 Ga0207693_10115091 3300025915 Bacteria 2111
71 Ga0207693_10148332 3300025915 Bacteria 1844
72 Ga0207649_10000053 3300025920 Bacteria 104949
73 Ga0207646_10229988 3300025922 Bacteria 1675
74 Ga0207694_10001227 3300025924 Bacteria 22225
75 Ga0207694_10004159 3300025924 Bacteria 11360
76 Ga0207700_10009163 3300025928 Bacteria 6167
77 Ga0207700_10057635 3300025928 Bacteria 2930
78 Ga0207700_10129510 3300025928 Bacteria 2058
79 Ga0207700_10185874 3300025928 Bacteria 1743
80 Ga0207664_10100048 3300025929 Bacteria 2393
81 Ga0207664_10146687 3300025929 Bacteria 2001
82 Ga0207664_10159700 3300025929 Bacteria 1922
83 Ga0207664_10196409 3300025929 Bacteria 1739
84 Ga0207664_10219478 3300025929 Bacteria 1648
85 Ga0207706_10078077 3300025933 Bacteria 2912
86 Ga0207667_10013837 3300025949 Bacteria 9217
87 Ga0207703_10162866 3300026035 Bacteria 1955
88 Ga0207702_10018478 3300026078 Bacteria 5768
89 Ga0207702_10025488 3300026078 Bacteria 4908
90 Ga0207702_10048140 3300026078 Bacteria 3595
91 Ga0207702_10222253 3300026078 Bacteria 1760
92 Ga0207675_100288953 3300026118 Bacteria 1595
93 Ga0268266_10059616 3300028379 Bacteria 3288
94 Ga0265332_10001511 3300031238 Bacteria 12914
95 Ga0265340_10009803 3300031247 Bacteria 5133
96 Ga0265339_10008647 3300031249 Bacteria 6461
97 Ga0265331_10000020 3300031250 Bacteria 258149
98 Ga0265331_10000733 3300031250 Bacteria 27661
99 Ga0265331_10043356 3300031250 Bacteria 2179
100 Ga0265327_10000105 3300031251 Bacteria 185022
101 Ga0307509_10000051 3300031507 Bacteria 165037
102 Ga0265314_10028553 3300031711 Bacteria 4158
103 Ga0265314_10030119 3300031711 Bacteria 4022
104 Ga0265314_10051184 3300031711 Bacteria 2878
105 Ga0265342_10000109 3300031712 Bacteria 91321
106 Ga0373946_0066001 3300035171 Bacteria 1551
107 Ga0373931_0015499 3300035691 Bacteria 3740
108 Ga0373935_0034004 3300035692 Bacteria 3176
109 Ga0395899_0170813 3300037312 Bacteria 1531
110 Ga0436364_0194031 3300037853 Bacteria 28377
111 Ga0436364_0441956 3300037853 Bacteria 1553
112 Ga0436364_0461464 3300037853 Bacteria 3709
113 Ga0436364_0542842 3300037853 Bacteria 26703
114 Ga0436364_0707697 3300037853 Bacteria 10282
115 Ga0436364_0995711 3300037853 Bacteria 2731
116 Ga0436364_1314743 3300037853 Bacteria 4050
117 Ga0436364_1437002 3300037853 Bacteria 3185
118 Ga0395901_0052767 3300038443 Bacteria 4226
119 Ga0436365_1826447 3300039437 Bacteria 1746
120 Ga0436360_0381407 3300039438 Bacteria 2591
121 Ga0436360_0799645 3300039438 Bacteria 2850
122 Ga0436360_1138446 3300039438 Bacteria 3979
123 Ga0436361_0123701 3300039447 Bacteria 4268
124 Ga0436361_0214900 3300039447 Bacteria 36416
125 Ga0436361_0274606 3300039447 Bacteria 34752
126 Ga0436361_0380308 3300039447 Bacteria 7738
127 Ga0436361_0409647 3300039447 Bacteria 2919
128 Ga0436361_0556958 3300039447 Bacteria 3427
129 Ga0436361_0778119 3300039447 Bacteria 23766
130 Ga0436361_0925593 3300039447 Bacteria 2315
131 Ga0436363_1072597 3300039450 Bacteria 5918
132 Ga0436362_0209881 3300039453 Bacteria 5750
133 Ga0436362_0387561 3300039453 Bacteria 2996
134 Ga0436362_0882885 3300039453 Bacteria 3206
135 Ga0466967_0175321 3300045976 Bacteria 2020
136 Ga0495580_0063639 3300046472 Bacteria 2586
137 Ga0495667_0044061 3300046559 Bacteria 2955
138 Ga0495634_0045651 3300046642 Bacteria 2961
139 Ga0495581_0036741 3300047315 Bacteria 2834
140 Ga0495686_0007996 3300047472 Bacteria 7842
141 Ga0496104_0000797 3300048907 Bacteria 27063
142 Ga0496104_0016453 3300048907 Bacteria 6717
143 Ga0496104_0050002 3300048907 Bacteria 3944
144 Ga0496104_0091469 3300048907 Bacteria 2908
145 Ga0496104_0113809 3300048907 Bacteria 2594
146 Ga0496105_0000312 3300048908 Bacteria 31860
147 Ga0496105_0003740 3300048908 Bacteria 11331
148 Ga0496105_0004046 3300048908 Bacteria 10976
149 Ga0496110_0019910 3300048913 Bacteria 5656
150 Ga0496112_0000805 3300048915 Bacteria 22117
151 Ga0496112_0220965 3300048915 Bacteria 1851
152 Ga0496113_0084234 3300048916 Bacteria 2440
153 Ga0496113_0213753 3300048916 Bacteria 1536
154 Ga0496115_0035561 3300048918 Bacteria 3941
155 Ga0496115_0039703 3300048918 Bacteria 3739
156 Ga0496119_0000795 3300048922 Bacteria 42283
157 Ga0496119_0072219 3300048922 Bacteria 2017
158 Ga0496125_0137034 3300048928 Bacteria 1710
159 Ga0501034_0329067 3300049571 Bacteria 1460
160 Ga0501046_0007709 3300049580 Bacteria 9439
161 Ga0501072_0166280 3300049588 Bacteria 1760
162 Ga0501079_0154473 3300049741 Bacteria 1789
163 Ga0501080_0010258 3300049742 Bacteria 8566
164 Ga0501081_0094281 3300049743 Bacteria 2109
165 Ga0501044_0126168 3300049823 Bacteria 2556
166 Ga0501044_0298252 3300049823 Bacteria 1541
167 Ga0500645_001410 3300053730 Bacteria 12244
168 2837679537 2837678835 Bacteria 5252418
169 2883296135 2883291878 Bacteria 5894118
170 2883358887 2883354860 Bacteria 5865246
171 2894817511 2894817345 Bacteria 4892941
172 8045866307 8045864390 Bacteria 5043873
173 Ga0207693_10005024
174 JGI25153J46596_10023451
175 Ga0055536_1028721
176 Ga0065165_1000649
177 Ga0070661_100000041
178 Ga0070709_10032456
179 Ga0070709_10064716
180 Ga0070709_10117917
181 Ga0070714_100057811
182 Ga0070714_100113073
183 Ga0070714_100245040
184 Ga0070713_100039023
185 Ga0070713_100172870
186 Ga0070710_10000812
187 Ga0070711_100003711
188 Ga0070711_100062781
189 Ga0070700_100086414
190 Ga0070708_100098453
191 Ga0070706_100066850
192 Ga0070707_100045842
193 Ga0070699_100028774
194 Ga0070665_100028417
195 Ga0068855_100047697
196 Ga0068856_100014419
197 Ga0068856_100112659
198 Ga0068856_100180894
199 Ga0068856_100347951
200 Ga0070717_10164367
201 Ga0070712_100000018
202 Ga0070712_100007223
203 Ga0070712_100042231
204 Ga0075370_10098048
205 Ga0099795_10000680
206 Ga0105240_10048227
207 Ga0105240_10097888
208 Ga0105240_10198840
209 Ga0105240_10305650
210 Ga0105241_10019391
211 Ga0105237_10006391
212 Ga0105237_10147762
213 Ga0105238_10000490
214 Ga0105238_10035495
215 Ga0105238_10045808
216 Ga0099796_10010825
217 Ga0105239_10275681
218 Ga0182008_10044994
219 Ga0213872_10000195
220 Ga0213872_10000649
221 Ga0213872_10005462
222 Ga0213872_10033885
223 Ga0213872_10036321
224 Ga0213874_10011310
225 Ga0213875_10000091
226 Ga0213875_10001018
227 Ga0213875_10006926
228 Ga0209026_1002061
229 Ga0209675_1001492
230 Ga0209676_1000026
231 Ga0207692_10026593
232 Ga0207699_10051117
233 Ga0207699_10105516
234 Ga0207684_10252588
235 Ga0207695_10005905
236 Ga0207695_10059509
237 Ga0207695_10163640
238 Ga0207695_10189422
239 Ga0207671_10148314
240 Ga0207693_10000145
241 Ga0207693_10083148
242 Ga0207693_10115091
243 Ga0207693_10148332
244 Ga0207649_10000053
245 Ga0207646_10229988
246 Ga0207694_10001227
247 Ga0207694_10004159
248 Ga0207700_10009163
249 Ga0207700_10057635
250 Ga0207700_10129510
251 Ga0207700_10185874
252 Ga0207664_10100048
253 Ga0207664_10146687
254 Ga0207664_10159700
255 Ga0207664_10196409
256 Ga0207664_10219478
257 Ga0207706_10078077
258 Ga0207667_10013837
259 Ga0207703_10162866
260 Ga0207702_10018478
261 Ga0207702_10025488
262 Ga0207702_10048140
263 Ga0207702_10222253
264 Ga0207675_100288953
265 Ga0268266_10059616
266 Ga0265332_10001511
267 Ga0265340_10009803
268 Ga0265339_10008647
269 Ga0265331_10000020
270 Ga0265331_10000733
271 Ga0265331_10043356
272 Ga0265327_10000105
273 Ga0307509_10000051
274 Ga0265314_10028553
275 Ga0265314_10030119
276 Ga0265314_10051184
277 Ga0265342_10000109
278 Ga0373946_0066001
279 Ga0373931_0015499
280 Ga0373935_0034004
281 Ga0395899_0170813
282 Ga0436364_0194031
283 Ga0436364_0441956
284 Ga0436364_0461464
285 Ga0436364_0542842
286 Ga0436364_0707697
287 Ga0436364_0995711
288 Ga0436364_1314743
289 Ga0436364_1437002
290 Ga0395901_0052767
291 Ga0436365_1826447
292 Ga0436360_0381407
293 Ga0436360_0799645
294 Ga0436360_1138446
295 Ga0436361_0123701
296 Ga0436361_0214900
297 Ga0436361_0274606
298 Ga0436361_0380308
299 Ga0436361_0409647
300 Ga0436361_0556958
301 Ga0436361_0778119
302 Ga0436361_0925593
303 Ga0436363_1072597
304 Ga0436362_0209881
305 Ga0436362_0387561
306 Ga0436362_0882885
307 Ga0466967_0175321
308 Ga0495580_0063639
309 Ga0495667_0044061
310 Ga0495634_0045651
311 Ga0495581_0036741
312 Ga0495686_0007996
313 Ga0496104_0000797
314 Ga0496104_0016453
315 Ga0496104_0050002
316 Ga0496104_0091469
317 Ga0496104_0113809
318 Ga0496105_0000312
319 Ga0496105_0003740
320 Ga0496105_0004046
321 Ga0496110_0019910
322 Ga0496112_0000805
323 Ga0496112_0220965
324 Ga0496113_0084234
325 Ga0496113_0213753
326 Ga0496115_0035561
327 Ga0496115_0039703
328 Ga0496119_0000795
329 Ga0496119_0072219
330 Ga0496125_0137034
331 Ga0501034_0329067
332 Ga0501046_0007709
333 Ga0501072_0166280
334 Ga0501079_0154473
335 Ga0501080_0010258
336 Ga0501081_0094281
337 Ga0501044_0126168
338 Ga0501044_0298252
339 Ga0500645_001410
340 2837679537
341 2883296135
342 2883358887
343 2894817511
344 8045866307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01565

FAD_binding_4

FAD binding domain

24

171

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.8397 8 386
8jdx-assembly1.cif.gz_A crystal structure of mldhd in complex with 2-ketoisovaleric acid 0.8237 8 381
7qh2-assembly1.cif.gz_F cryo-em structure of ldh-etfab complex from acetobacterium woodii 0.8234 8 386
3pm9-assembly1.cif.gz_A crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution 0.8191 8 381
8jdc-assembly1.cif.gz_A crystal structure of mldhd in apo form 0.8191 8 381
ID Description Score Start End Superfamily
af_P52073_9_189_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9174 16 185 3.30.465.10
af_P0AEP9_110_230_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8706 58 181 3.30.465.10
af_P9WIT1_14_227_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8676 8 181 3.30.465.10
af_K7K4A7_263_384_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.861 58 181 3.30.465.10
af_A0A368ULS0_107_341_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.8603 8 184 3.30.465.10
ID Description Score Start End GO Terms
AF-B4R9G9-F1-model_v4 FAD/FMN-containing dehydrogenase 0.9672 1 385 GO:0003824
GO:0071949
AF-B4R9G9-F1-model_v4 FAD/FMN-containing dehydrogenase 0.9623 1 385 GO:0003824
GO:0071949
AF-A0A6P1WC40-F1-model_v4 deleted 0.9588 7 382
AF-A0A7Y4UPJ5-F1-model_v4 FAD-binding protein 0.9564 1 382 GO:0003824
GO:0071949
AF-A0A7C1T8X6-F1-model_v4 FAD-binding protein 0.9562 9 286 GO:0003824
GO:0071949

Map