F259505

General Info

Members Datasets Scaffolds Average Seq Length
171 117 171 187

Family's Representative Sequence

Representative Sequence 3300049528|Ga0501312_020988|Ga0501312_020988_155_826
Length 223
Sequence MGAATIAPDLTTLGLRVANGVHRPKPRKRYQVVRMDTDDIKKGLKVMLDGIKDPFIVVEAQFVKPGKGQAFTRMKAKNMATGAVLERTIKSGDKIELADVEQRMMQYIYPEGTDFVFMDPATGEQFYIMGEKLGDDSRWLSDGMNINVTLHNGQPIGVDLPANVVLQITTCEPGVKGDTASGATKPATLSTGAVINVPLFVQEGEWIKVDTADGKYLERVNNR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
49 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
50 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
51 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
52 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
53 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
64 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
70 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
71 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
72 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
73 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
74 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
75 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
79 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
83 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
114 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
115 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
116 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.81
Metatranscriptomes 8.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 0.58
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 9.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10184288 3300003322 Bacteria 2511
2 rootH1_10113803 3300003323 Bacteria 3797
3 Ga0070683_100759796 3300005329 Bacteria 929
4 Ga0070690_100779660 3300005330 Bacteria 740
5 Ga0070713_101178286 3300005436 Bacteria 741
6 Ga0070678_100073182 3300005456 Bacteria 2571
7 Ga0070707_100017726 3300005468 Bacteria 6696
8 Ga0070707_100151839 3300005468 Bacteria 2255
9 Ga0070707_100518878 3300005468 Bacteria 1153
10 Ga0070698_100043413 3300005471 Bacteria 4609
11 Ga0070696_100093748 3300005546 Bacteria 2141
12 Ga0070696_100398140 3300005546 Bacteria 1077
13 Ga0068855_100268447 3300005563 Bacteria 1898
14 Ga0068856_100070811 3300005614 Bacteria 3451
15 Ga0068856_100512458 3300005614 Bacteria 1221
16 Ga0070702_100704004 3300005615 Bacteria 770
17 Ga0068863_100064748 3300005841 Bacteria 3458
18 Ga0068860_101495456 3300005843 Bacteria 697
19 Ga0070717_11257789 3300006028 Bacteria 673
20 Ga0075428_100024232 3300006844 Bacteria 6713
21 Ga0075428_100157069 3300006844 Bacteria 2470
22 Ga0075430_100174869 3300006846 Bacteria 1786
23 Ga0075430_100536680 3300006846 Bacteria 965
24 Ga0075431_100200697 3300006847 Bacteria 2041
25 Ga0075431_100835152 3300006847 Bacteria 893
26 Ga0075433_10127855 3300006852 Bacteria 2257
27 Ga0075429_100389807 3300006880 Bacteria 1220
28 Ga0075429_100424511 3300006880 Bacteria 1164
29 Ga0075436_100092426 3300006914 Bacteria 2103
30 Ga0111539_10961265 3300009094 Bacteria 993
31 Ga0105247_10014170 3300009101 Bacteria 4783
32 Ga0105242_10637090 3300009176 Bacteria 1035
33 Ga0105237_10823603 3300009545 Bacteria 935
34 Ga0105238_12001629 3300009551 Bacteria 613
35 Ga0206356_10997051 3300020070 Bacteria 1178
36 Ga0206349_1421831 3300020075 Bacteria 1070
37 Ga0206351_10903279 3300020077 Unclassified 1140
38 Ga0206352_11038972 3300020078 Bacteria 759
39 Ga0206350_11310930 3300020080 Bacteria 870
40 Ga0206354_11268062 3300020081 Bacteria 984
41 Ga0206353_10445422 3300020082 Bacteria 649
42 Ga0224712_10121822 3300022467 Bacteria 1130
43 Ga0224712_10148958 3300022467 Bacteria 1036
44 Ga0207710_10002802 3300025900 Bacteria 7959
45 Ga0207684_10459496 3300025910 Bacteria 1093
46 Ga0207646_10020221 3300025922 Bacteria 6171
47 Ga0207646_10031843 3300025922 Bacteria 4774
48 Ga0207670_10002621 3300025936 Bacteria 9460
49 Ga0207661_10014262 3300025944 Bacteria 5820
50 Ga0207678_10130985 3300026067 Bacteria 2139
51 Ga0207702_10165017 3300026078 Bacteria 2025
52 Ga0207641_10039137 3300026088 Bacteria 3965
53 Ga0207648_10745395 3300026089 Bacteria 909
54 Ga0207675_100467240 3300026118 Bacteria 1252
55 Ga0207683_10130185 3300026121 Bacteria 2263
56 Ga0209998_10063769 3300027717 Bacteria 871
57 Ga0207428_10144961 3300027907 Bacteria 1810
58 Ga0307513_10291230 3300031456 Bacteria 1404
59 Ga0316575_10005792 3300031665 Bacteria 4413
60 Ga0316575_10028294 3300031665 Bacteria 2185
61 Ga0316579_10000966 3300031691 Bacteria 10072
62 Ga0316576_10013026 3300031727 Bacteria 5511
63 Ga0316576_10040540 3300031727 Bacteria 3348
64 Ga0316576_10154769 3300031727 Bacteria 1728
65 Ga0316576_10166514 3300031727 Bacteria 1663
66 Ga0316578_10011260 3300031728 Bacteria 4670
67 Ga0316578_10056417 3300031728 Unclassified 2307
68 Ga0316577_10001361 3300031733 Bacteria 11504
69 Ga0316577_10003297 3300031733 Bacteria 8136
70 Ga0307413_10228878 3300031824 Bacteria 1364
71 Ga0307413_10261493 3300031824 Bacteria 1290
72 Ga0307410_10574125 3300031852 Bacteria 937
73 Ga0307406_10039117 3300031901 Bacteria 2940
74 Ga0307409_100105013 3300031995 Bacteria 2354
75 Ga0307409_100910423 3300031995 Bacteria 894
76 Ga0307415_100190484 3300032126 Bacteria 1618
77 Ga0316583_10008181 3300032133 Bacteria 3767
78 Ga0316583_10031618 3300032133 Bacteria 1884
79 Ga0316583_10032031 3300032133 Unclassified 1870
80 Ga0316583_10074925 3300032133 Bacteria 1183
81 Ga0316583_10208315 3300032133 Bacteria 678
82 Ga0316585_10005085 3300032137 Bacteria 3700
83 Ga0316585_10056705 3300032137 Bacteria 1261
84 Ga0316580_10006757 3300032139 Bacteria 3392
85 Ga0316580_10058580 3300032139 Bacteria 1183
86 Ga0307507_10017442 3300033179 Bacteria 8242
87 Ga0316574_0002710 3300035398 Bacteria 8962
88 Ga0316574_0045823 3300035398 Bacteria 2709
89 Ga0316574_0252543 3300035398 Bacteria 1126
90 Ga0316574_0333218 3300035398 Bacteria 962
91 Ga0373931_0477807 3300035691 Bacteria 801
92 Ga0373927_0093623 3300035695 Bacteria 1952
93 Ga0373937_0501650 3300036401 Bacteria 1153
94 Ga0316582_0000042 3300036647 Bacteria 30662
95 Ga0316582_0006394 3300036647 Bacteria 6180
96 Ga0316582_0007245 3300036647 Bacteria 5898
97 Ga0316582_0011534 3300036647 Bacteria 4890
98 Ga0316582_0130662 3300036647 Unclassified 1686
99 Ga0316582_0197940 3300036647 Bacteria 1370
100 Ga0316582_0334274 3300036647 Bacteria 1042
101 Ga0316582_0459823 3300036647 Bacteria 877
102 Ga0316584_0000311 3300036712 Bacteria 25003
103 Ga0316584_0009727 3300036712 Bacteria 6688
104 Ga0316584_0017956 3300036712 Bacteria 5097
105 Ga0316584_0528363 3300036712 Bacteria 826
106 Ga0395905_0038141 3300037471 Bacteria 4508
107 Ga0316581_0004001 3300037588 Bacteria 3722
108 Ga0400490_22698 3300038726 Bacteria 3618
109 Ga0400491_04747 3300038727 Bacteria 4240
110 Ga0400491_16725 3300038727 Bacteria 4505
111 Ga0400488_58971 3300038741 Unclassified 1485
112 Ga0400486_12177 3300038742 Bacteria 1595
113 Ga0400483_019139 3300039062 Bacteria 24805
114 Ga0400483_087748 3300039062 Unclassified 1066
115 Ga0400483_153771 3300039062 Bacteria 4588
116 Ga0400483_223765 3300039062 Unclassified 1516
117 Ga0400483_265586 3300039062 Bacteria 6579
118 Ga0436362_0683468 3300039453 Bacteria 650
119 Ga0436362_0814430 3300039453 Bacteria 1151
120 Ga0439436_0076854 3300041404 Bacteria 930
121 Ga0451845_0450616 3300041501 Bacteria 618
122 Ga0451843_1448135 3300041509 Bacteria 873
123 Ga0453683_0257401 3300044673 Bacteria 1113
124 Ga0453684_0000100 3300044712 Bacteria 368331
125 Ga0453684_0000152 3300044712 Bacteria 305949
126 Ga0453684_0347985 3300044712 Bacteria 1672
127 Ga0466968_0311491 3300044735 Bacteria 759
128 Ga0466960_0074555 3300044901 Bacteria 1696
129 Ga0466959_0388960 3300045049 Unclassified 949
130 Ga0451576_0120789 3300045051 Bacteria 2728
131 Ga0451576_1000179 3300045051 Bacteria 876
132 Ga0495664_0039106 3300046477 Bacteria 2802
133 Ga0495634_0407774 3300046642 Bacteria 806
134 Ga0495623_0049502 3300046679 Bacteria 2663
135 Ga0495646_0085138 3300046680 Bacteria 1835
136 Ga0495624_0048409 3300046690 Bacteria 2698
137 Ga0495660_0137829 3300046810 Unclassified 1217
138 Ga0495675_0109383 3300047444 Bacteria 1726
139 Ga0496115_0024467 3300048918 Unclassified 4694
140 Ga0501308_034801 3300049128 Unclassified 689
141 Ga0501305_029041 3300049161 Unclassified 854
142 Ga0501312_020988 3300049528 Unclassified 970
143 Ga0501034_0016885 3300049571 Bacteria 7485
144 Ga0501034_0046814 3300049571 Bacteria 4370
145 Ga0501038_0043571 3300049574 Bacteria 3902
146 Ga0501039_0614461 3300049575 Bacteria 852
147 Ga0501047_0123969 3300049581 Bacteria 2464
148 Ga0501070_0500077 3300049586 Unclassified 977
149 Ga0501073_0626365 3300049589 Bacteria 743
150 Ga0501075_0055464 3300049591 Bacteria 2982
151 Ga0501076_0504679 3300049592 Bacteria 997
152 Ga0501079_0494150 3300049741 Bacteria 962
153 Ga0501079_0547797 3300049741 Bacteria 910
154 Ga0501044_0040214 3300049823 Bacteria 4874
155 nmdc:mga05p37_319432_c1 3300050507 Bacteria 1838
156 nmdc:mga0qj67_262416_c1 3300050509 Bacteria 1401
157 nmdc:mga0qj67_454515_c1 3300050509 Bacteria 1031
158 nmdc:mga0qj67_523579_c1 3300050509 Bacteria 952
159 nmdc:mga06r32_219609_c1 3300050510 Bacteria 1889
160 nmdc:mga06r32_221985_c1 3300050510 Bacteria 1878
161 nmdc:mga08y16_101352_c1 3300050511 Bacteria 2997
162 nmdc:mga08y16_724660_c1 3300050511 Bacteria 992
163 nmdc:mga0rr50_328767_c1 3300050513 Bacteria 1283
164 nmdc:mga0rr50_56015_c1 3300050513 Unclassified 2944
165 nmdc:mga08x19_68877_c1 3300050514 Bacteria 2304
166 nmdc:mga08x19_764969_c1 3300050514 Unclassified 686
167 nmdc:mga0a205_84643_c1 3300050515 Bacteria 3063
168 Ga0500603_060589 3300053150 Unclassified 1058
169 Ga0501084_0230345 3300054114 Bacteria 1564
170 Ga0587077_017093 3300059493 Bacteria 1231
171 Ga0587062_006235 3300059639 Bacteria 1348

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_764969_c1 nmdc:mga08x19_764969_c1_203_673 156
2 3300003323 rootH1_10113803 rootH1_101138032 169
3 3300049586 Ga0501070_0500077 Ga0501070_0500077_212_733 173
4 3300027717 Ga0209998_10063769 Ga0209998_100637692 175
5 3300049589 Ga0501073_0626365 Ga0501073_0626365_17_556 179
6 3300049591 Ga0501075_0055464 Ga0501075_0055464_2291_2830 179
7 3300054114 Ga0501084_0230345 Ga0501084_0230345_421_960 179
8 3300006844 Ga0075428_100157069 Ga0075428_1001570692 184
9 3300006847 Ga0075431_100835152 Ga0075431_1008351522 184
10 3300006852 Ga0075433_10127855 Ga0075433_101278552 184
11 3300006914 Ga0075436_100092426 Ga0075436_1000924262 184
12 3300009545 Ga0105237_10823603 Ga0105237_108236032 184
13 3300038726 Ga0400490_22698 Ga0400490_22698_811_1368 184
14 3300038727 Ga0400491_04747 Ga0400491_04747_566_1123 184
15 3300039453 Ga0436362_0814430 Ga0436362_0814430_264_821 184
16 3300045049 Ga0466959_0388960 Ga0466959_0388960_190_747 184
17 3300046477 Ga0495664_0039106 Ga0495664_0039106_334_891 184
18 3300046642 Ga0495634_0407774 Ga0495634_0407774_152_709 184
19 3300046679 Ga0495623_0049502 Ga0495623_0049502_1896_2453 184
20 3300046680 Ga0495646_0085138 Ga0495646_0085138_274_831 184
21 3300046690 Ga0495624_0048409 Ga0495624_0048409_970_1527 184
22 3300047444 Ga0495675_0109383 Ga0495675_0109383_257_814 184
23 3300049575 Ga0501039_0614461 Ga0501039_0614461_250_810 184
24 3300049592 Ga0501076_0504679 Ga0501076_0504679_26_586 184
25 3300049741 Ga0501079_0494150 Ga0501079_0494150_222_779 184
26 3300050510 nmdc:mga06r32_219609_c1 nmdc:mga06r32_219609_c1_1150_1710 184
27 3300050513 nmdc:mga0rr50_328767_c1 nmdc:mga0rr50_328767_c1_618_1175 184
28 3300050514 nmdc:mga08x19_68877_c1 nmdc:mga08x19_68877_c1_725_1282 184
29 3300050515 nmdc:mga0a205_84643_c1 nmdc:mga0a205_84643_c1_583_1140 184
30 3300005330 Ga0070690_100779660 Ga0070690_1007796601 185
31 3300005468 Ga0070707_100151839 Ga0070707_1001518392 185
32 3300005468 Ga0070707_100518878 Ga0070707_1005188782 185
33 3300005471 Ga0070698_100043413 Ga0070698_1000434134 185
34 3300005546 Ga0070696_100093748 Ga0070696_1000937482 185
35 3300006844 Ga0075428_100024232 Ga0075428_1000242322 185
36 3300006846 Ga0075430_100536680 Ga0075430_1005366802 185
37 3300006847 Ga0075431_100200697 Ga0075431_1002006972 185
38 3300006880 Ga0075429_100424511 Ga0075429_1004245112 185
39 3300020080 Ga0206350_11310930 Ga0206350_113109302 185
40 3300025922 Ga0207646_10020221 Ga0207646_100202214 185
41 3300036647 Ga0316582_0334274 Ga0316582_0334274_35_598 185
42 3300038742 Ga0400486_12177 Ga0400486_12177_777_1337 185
43 3300044735 Ga0466968_0311491 Ga0466968_0311491_55_615 185
44 3300049741 Ga0501079_0547797 Ga0501079_0547797_196_759 185
45 3300050507 nmdc:mga05p37_319432_c1 nmdc:mga05p37_319432_c1_217_780 185
46 3300050509 nmdc:mga0qj67_454515_c1 nmdc:mga0qj67_454515_c1_386_949 185
47 3300050509 nmdc:mga0qj67_523579_c1 nmdc:mga0qj67_523579_c1_325_888 185
48 3300050510 nmdc:mga06r32_221985_c1 nmdc:mga06r32_221985_c1_826_1389 185
49 3300005329 Ga0070683_100759796 Ga0070683_1007597961 186
50 3300005436 Ga0070713_101178286 Ga0070713_1011782861 186
51 3300005456 Ga0070678_100073182 Ga0070678_1000731823 186
52 3300005468 Ga0070707_100017726 Ga0070707_1000177262 186
53 3300005546 Ga0070696_100398140 Ga0070696_1003981401 186
54 3300005563 Ga0068855_100268447 Ga0068855_1002684473 186
55 3300005614 Ga0068856_100070811 Ga0068856_1000708111 186
56 3300005614 Ga0068856_100512458 Ga0068856_1005124582 186
57 3300005615 Ga0070702_100704004 Ga0070702_1007040041 186
58 3300005841 Ga0068863_100064748 Ga0068863_1000647483 186
59 3300005843 Ga0068860_101495456 Ga0068860_1014954561 186
60 3300006028 Ga0070717_11257789 Ga0070717_112577891 186
61 3300006846 Ga0075430_100174869 Ga0075430_1001748692 186
62 3300006880 Ga0075429_100389807 Ga0075429_1003898072 186
63 3300009094 Ga0111539_10961265 Ga0111539_109612652 186
64 3300009101 Ga0105247_10014170 Ga0105247_100141703 186
65 3300009176 Ga0105242_10637090 Ga0105242_106370902 186
66 3300009551 Ga0105238_12001629 Ga0105238_120016291 186
67 3300020070 Ga0206356_10997051 Ga0206356_109970512 186
68 3300020075 Ga0206349_1421831 Ga0206349_14218312 186
69 3300020077 Ga0206351_10903279 Ga0206351_109032792 186
70 3300020078 Ga0206352_11038972 Ga0206352_110389722 186
71 3300020081 Ga0206354_11268062 Ga0206354_112680621 186
72 3300020082 Ga0206353_10445422 Ga0206353_104454221 186
73 3300022467 Ga0224712_10121822 Ga0224712_101218222 186
74 3300022467 Ga0224712_10148958 Ga0224712_101489581 186
75 3300025900 Ga0207710_10002802 Ga0207710_100028025 186
76 3300025910 Ga0207684_10459496 Ga0207684_104594961 186
77 3300025922 Ga0207646_10031843 Ga0207646_100318431 186
78 3300025936 Ga0207670_10002621 Ga0207670_100026215 186
79 3300025944 Ga0207661_10014262 Ga0207661_100142624 186
80 3300026067 Ga0207678_10130985 Ga0207678_101309852 186
81 3300026078 Ga0207702_10165017 Ga0207702_101650173 186
82 3300026088 Ga0207641_10039137 Ga0207641_100391373 186
83 3300026089 Ga0207648_10745395 Ga0207648_107453951 186
84 3300026118 Ga0207675_100467240 Ga0207675_1004672401 186
85 3300026121 Ga0207683_10130185 Ga0207683_101301853 186
86 3300027907 Ga0207428_10144961 Ga0207428_101449611 186
87 3300031456 Ga0307513_10291230 Ga0307513_102912301 186
88 3300031665 Ga0316575_10005792 Ga0316575_100057923 186
89 3300031665 Ga0316575_10028294 Ga0316575_100282942 186
90 3300031691 Ga0316579_10000966 Ga0316579_100009667 186
91 3300031727 Ga0316576_10013026 Ga0316576_100130264 186
92 3300031727 Ga0316576_10040540 Ga0316576_100405405 186
93 3300031727 Ga0316576_10154769 Ga0316576_101547691 186
94 3300031727 Ga0316576_10166514 Ga0316576_101665142 186
95 3300031728 Ga0316578_10011260 Ga0316578_100112605 186
96 3300031728 Ga0316578_10056417 Ga0316578_100564172 186
97 3300031733 Ga0316577_10001361 Ga0316577_100013614 186
98 3300031733 Ga0316577_10003297 Ga0316577_100032974 186
99 3300031824 Ga0307413_10228878 Ga0307413_102288782 186
100 3300031824 Ga0307413_10261493 Ga0307413_102614932 186
101 3300031852 Ga0307410_10574125 Ga0307410_105741252 186
102 3300031995 Ga0307409_100105013 Ga0307409_1001050132 186
103 3300031995 Ga0307409_100910423 Ga0307409_1009104231 186
104 3300032133 Ga0316583_10008181 Ga0316583_100081813 186
105 3300032133 Ga0316583_10031618 Ga0316583_100316181 186
106 3300032133 Ga0316583_10032031 Ga0316583_100320312 186
107 3300032133 Ga0316583_10074925 Ga0316583_100749252 186
108 3300032133 Ga0316583_10208315 Ga0316583_102083151 186
109 3300032137 Ga0316585_10005085 Ga0316585_100050851 186
110 3300032137 Ga0316585_10056705 Ga0316585_100567051 186
111 3300032139 Ga0316580_10006757 Ga0316580_100067573 186
112 3300032139 Ga0316580_10058580 Ga0316580_100585802 186
113 3300033179 Ga0307507_10017442 Ga0307507_100174424 186
114 3300035398 Ga0316574_0002710 Ga0316574_0002710_3873_4436 186
115 3300035398 Ga0316574_0045823 Ga0316574_0045823_282_845 186
116 3300035398 Ga0316574_0252543 Ga0316574_0252543_211_774 186
117 3300035398 Ga0316574_0333218 Ga0316574_0333218_382_945 186
118 3300035691 Ga0373931_0477807 Ga0373931_0477807_172_735 186
119 3300035695 Ga0373927_0093623 Ga0373927_0093623_354_914 186
120 3300036401 Ga0373937_0501650 Ga0373937_0501650_338_901 186
121 3300036647 Ga0316582_0000042 Ga0316582_0000042_26646_27209 186
122 3300036647 Ga0316582_0006394 Ga0316582_0006394_3568_4137 186
123 3300036647 Ga0316582_0007245 Ga0316582_0007245_2055_2624 186
124 3300036647 Ga0316582_0011534 Ga0316582_0011534_848_1411 186
125 3300036647 Ga0316582_0130662 Ga0316582_0130662_665_1228 186
126 3300036647 Ga0316582_0197940 Ga0316582_0197940_501_1064 186
127 3300036647 Ga0316582_0459823 Ga0316582_0459823_49_612 186
128 3300036712 Ga0316584_0000311 Ga0316584_0000311_21058_21621 186
129 3300036712 Ga0316584_0009727 Ga0316584_0009727_5483_6046 186
130 3300036712 Ga0316584_0017956 Ga0316584_0017956_4472_5041 186
131 3300036712 Ga0316584_0528363 Ga0316584_0528363_227_790 186
132 3300037471 Ga0395905_0038141 Ga0395905_0038141_3232_3798 186
133 3300037588 Ga0316581_0004001 Ga0316581_0004001_1092_1655 186
134 3300038727 Ga0400491_16725 Ga0400491_16725_2719_3348 186
135 3300038741 Ga0400488_58971 Ga0400488_58971_680_1243 186
136 3300039062 Ga0400483_019139 Ga0400483_019139_7977_8549 186
137 3300039062 Ga0400483_087748 Ga0400483_087748_234_797 186
138 3300039062 Ga0400483_153771 Ga0400483_153771_734_1297 186
139 3300039062 Ga0400483_223765 Ga0400483_223765_281_844 186
140 3300039062 Ga0400483_265586 Ga0400483_265586_1567_2130 186
141 3300039453 Ga0436362_0683468 Ga0436362_0683468_49_615 186
142 3300041404 Ga0439436_0076854 Ga0439436_0076854_256_819 186
143 3300041501 Ga0451845_0450616 Ga0451845_0450616_14_577 186
144 3300041509 Ga0451843_1448135 Ga0451843_1448135_22_585 186
145 3300044673 Ga0453683_0257401 Ga0453683_0257401_414_986 186
146 3300044712 Ga0453684_0000100 Ga0453684_0000100_333874_334437 186
147 3300044712 Ga0453684_0000152 Ga0453684_0000152_237250_237813 186
148 3300044712 Ga0453684_0347985 Ga0453684_0347985_272_835 186
149 3300045051 Ga0451576_0120789 Ga0451576_0120789_647_1219 186
150 3300046810 Ga0495660_0137829 Ga0495660_0137829_524_1087 186
151 3300048918 Ga0496115_0024467 Ga0496115_0024467_916_1482 186
152 3300049571 Ga0501034_0016885 Ga0501034_0016885_5359_5922 186
153 3300049571 Ga0501034_0046814 Ga0501034_0046814_1873_2436 186
154 3300049574 Ga0501038_0043571 Ga0501038_0043571_3052_3615 186
155 3300049581 Ga0501047_0123969 Ga0501047_0123969_788_1351 186
156 3300049823 Ga0501044_0040214 Ga0501044_0040214_205_768 186
157 3300050509 nmdc:mga0qj67_262416_c1 nmdc:mga0qj67_262416_c1_76_636 186
158 3300050511 nmdc:mga08y16_101352_c1 nmdc:mga08y16_101352_c1_1226_1792 186
159 3300050511 nmdc:mga08y16_724660_c1 nmdc:mga08y16_724660_c1_135_698 186
160 3300050513 nmdc:mga0rr50_56015_c1 nmdc:mga0rr50_56015_c1_649_1215 186
161 3300053150 Ga0500603_060589 Ga0500603_060589_301_864 186
162 3300059493 Ga0587077_017093 Ga0587077_017093_221_784 186
163 3300003322 rootL2_10184288 rootL2_101842881 188
164 3300031901 Ga0307406_10039117 Ga0307406_100391173 188
165 3300032126 Ga0307415_100190484 Ga0307415_1001904843 188
166 3300044901 Ga0466960_0074555 Ga0466960_0074555_1010_1579 188
167 3300045051 Ga0451576_1000179 Ga0451576_1000179_82_648 188
168 3300049128 Ga0501308_034801 Ga0501308_034801_71_640 188
169 3300049161 Ga0501305_029041 Ga0501305_029041_159_728 188
170 3300049528 Ga0501312_020988 Ga0501312_020988_155_826 188
171 3300059639 Ga0587062_006235 Ga0587062_006235_661_1227 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

164

219

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

103

156

0.98

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

36

95

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9446 1 186
1ueb-assembly2.cif.gz_B crystal structure of translation elongation factor p from thermus thermophilus hb8 0.9368 1 186
3tre-assembly1.cif.gz_A structure of a translation elongation factor p (efp) from coxiella burnetii 0.9351 2 127
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9343 1 186
1ueb-assembly1.cif.gz_A crystal structure of translation elongation factor p from thermus thermophilus hb8 0.9268 1 186
ID Description Score Start End Superfamily
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9694 1 64 2.30.30.30
af_I1JVU1_126_189_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9668 66 127 2.40.50.140
af_I1L709_116_178_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9658 65 127 2.40.50.140
af_F4JUX3_135_197_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9599 66 127 2.40.50.140
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9537 65 127 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A6I4VDJ9-F1-model_v4 Elongation factor P (EF-P) 0.9665 1 188 GO:0003746
GO:0005737
GO:0043043
AF-R4I0G9-F1-model_v4 deleted 0.9646 1 187
AF-Q0AAU9-F1-model_v4 Elongation factor P (EF-P) 0.964 1 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A7C5LYS0-F1-model_v4 Elongation factor P (EF-P) 0.9621 1 188 GO:0003746
GO:0005737
GO:0043043
AF-A0A1J3K1Y6-F1-model_v4 Elongation factor P 0.9606 1 186 GO:0003746
GO:0005737
GO:0043043

Feature Viewer

pLDDT pTM Quality
94.01 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map