F259311

General Info

Members Datasets Scaffolds Average Seq Length
171 120 168 195

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0007260|Ga0495603_0007260_3662_4285
Length 207
Sequence VPFGARPPLVLASASPRRLSLLAQIGVVPDLVLAADVDETPHRAELPAPLAQRLADAKASVVRSDVKITTLGAPPLILAADTVVALGRRILPKATNESEARQCLTLLSGRRHRVLTAVTLALPDGTLRRRLVESQVRFKRLAPAEIARYLKSGEWQGKAGGYGIQGLAAAYIPWISGSYSNVVGLPLAEIRALLDGVSYFEAIEPSA

Samples

Sample ID Description Type Environment
1 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
2 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
3 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
67 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
70 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
92 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
93 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
100 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
101 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
108 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
111 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
119 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.58
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 4.68
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 14.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10327431 3300003322 Bacteria 1289
2 Ga0070666_10056488 3300005335 Bacteria 2650
3 Ga0070666_10091763 3300005335 Bacteria 2087
4 Ga0070682_100271548 3300005337 Bacteria 1232
5 Ga0070661_100000164 3300005344 Bacteria 54634
6 Ga0070709_10223184 3300005434 Bacteria 1344
7 Ga0070714_100136733 3300005435 Bacteria 2195
8 Ga0070714_100150425 3300005435 Bacteria 2097
9 Ga0070714_100866179 3300005435 Bacteria 876
10 Ga0070713_100147557 3300005436 Bacteria 2089
11 Ga0070713_100433055 3300005436 Bacteria 1233
12 Ga0070710_10240931 3300005437 Bacteria 1158
13 Ga0070681_10567061 3300005458 Bacteria 1049
14 Ga0070681_10602280 3300005458 Bacteria 1013
15 Ga0070706_100290517 3300005467 Bacteria 1526
16 Ga0070698_100031592 3300005471 Bacteria 5488
17 Ga0070698_100646571 3300005471 Bacteria 999
18 Ga0070698_100807581 3300005471 Bacteria 882
19 Ga0070679_100716749 3300005530 Bacteria 943
20 Ga0070686_100031079 3300005544 Bacteria 3262
21 Ga0068856_100526707 3300005614 Bacteria 1203
22 Ga0068861_100230518 3300005719 Bacteria 1570
23 Ga0068863_101215800 3300005841 Bacteria 760
24 Ga0068860_100000680 3300005843 Bacteria 39339
25 Ga0068862_100000193 3300005844 Bacteria 67697
26 Ga0068862_100055079 3300005844 Bacteria 3406
27 Ga0070717_10012961 3300006028 Bacteria 6368
28 Ga0070717_10170248 3300006028 Bacteria 1894
29 Ga0070717_10393710 3300006028 Bacteria 1244
30 Ga0070712_100033693 3300006175 Bacteria 3467
31 Ga0070712_100037067 3300006175 Bacteria 3321
32 Ga0070712_100172139 3300006175 Bacteria 1681
33 Ga0070712_100239552 3300006175 Bacteria 1445
34 Ga0070712_100535398 3300006175 Bacteria 985
35 Ga0075428_100058427 3300006844 Bacteria 4223
36 Ga0075435_100234520 3300007076 Bacteria 1559
37 Ga0099795_10023091 3300007788 Bacteria 2060
38 Ga0105240_10246131 3300009093 Bacteria 2070
39 Ga0111539_10269421 3300009094 Bacteria 1982
40 Ga0111539_10579905 3300009094 Bacteria 1306
41 Ga0105249_10000002 3300009553 Bacteria 376207
42 Ga0099796_10251880 3300010159 Bacteria 733
43 Ga0182008_10088973 3300014497 Bacteria 1521
44 Ga0157379_10328561 3300014968 Bacteria 1397
45 Ga0213873_10022443 3300021358 Bacteria 1495
46 Ga0213876_10023996 3300021384 Bacteria 3221
47 Ga0213875_10001688 3300021388 Bacteria 13887
48 Ga0213875_10062299 3300021388 Bacteria 1745
49 Ga0213875_10112801 3300021388 Bacteria 1269
50 Ga0207692_10107984 3300025898 Bacteria 1539
51 Ga0207692_10266563 3300025898 Bacteria 1031
52 Ga0207680_10036025 3300025903 Bacteria 2847
53 Ga0207699_10137062 3300025906 Bacteria 1604
54 Ga0207699_10198950 3300025906 Bacteria 1356
55 Ga0207699_10695661 3300025906 Bacteria 744
56 Ga0207707_10607247 3300025912 Bacteria 925
57 Ga0207695_10280963 3300025913 Bacteria 1558
58 Ga0207693_10036288 3300025915 Bacteria 3886
59 Ga0207693_10060261 3300025915 Bacteria 2973
60 Ga0207693_10211460 3300025915 Bacteria 1524
61 Ga0207663_10079994 3300025916 Bacteria 2136
62 Ga0207649_10000053 3300025920 Bacteria 104949
63 Ga0207652_10592135 3300025921 Bacteria 995
64 Ga0207700_10131134 3300025928 Bacteria 2047
65 Ga0207700_10252782 3300025928 Bacteria 1506
66 Ga0207700_10421390 3300025928 Bacteria 1173
67 Ga0207700_10840989 3300025928 Unclassified 821
68 Ga0207664_10162827 3300025929 Bacteria 1904
69 Ga0207664_10611102 3300025929 Bacteria 979
70 Ga0207644_10606507 3300025931 Bacteria 909
71 Ga0207670_10254451 3300025936 Bacteria 1359
72 Ga0207665_10099768 3300025939 Bacteria 2025
73 Ga0207661_10481727 3300025944 Bacteria 1133
74 Ga0207712_10000002 3300025961 Bacteria 706628
75 Ga0207703_10544275 3300026035 Bacteria 1094
76 Ga0207702_10085635 3300026078 Bacteria 2746
77 Ga0207702_10452129 3300026078 Bacteria 1246
78 Ga0207641_10003745 3300026088 Bacteria 13369
79 Ga0207676_10563281 3300026095 Bacteria 1090
80 Ga0207675_100273557 3300026118 Bacteria 1639
81 Ga0268266_10463604 3300028379 Bacteria 1206
82 Ga0268265_10000048 3300028380 Bacteria 178523
83 Ga0268264_10000304 3300028381 Bacteria 79130
84 Ga0268264_10601925 3300028381 Bacteria 1083
85 Ga0265331_10000020 3300031250 Bacteria 258149
86 Ga0265331_10000343 3300031250 Bacteria 49474
87 Ga0265327_10000105 3300031251 Bacteria 185022
88 Ga0307513_10147845 3300031456 Bacteria 2265
89 Ga0265314_10007136 3300031711 Bacteria 9736
90 Ga0265314_10099579 3300031711 Bacteria 1872
91 Ga0316583_10011880 3300032133 Bacteria 3142
92 Ga0316593_10079842 3300032168 Bacteria 1140
93 Ga0373944_0149776 3300035089 Bacteria 822
94 Ga0373941_0008575 3300035115 Bacteria 2544
95 Ga0373945_0233493 3300035116 Bacteria 773
96 Ga0373960_0037308 3300035121 Bacteria 1388
97 Ga0373931_0071185 3300035691 Bacteria 1899
98 Ga0373947_0043978 3300035725 Bacteria 2669
99 Ga0373937_0394325 3300036401 Bacteria 1313
100 Ga0395900_0316621 3300037418 Bacteria 1542
101 Ga0395900_0833884 3300037418 Bacteria 848
102 Ga0395898_0607862 3300037466 Bacteria 1036
103 Ga0436364_0505500 3300037853 Bacteria 1165
104 Ga0436364_0541917 3300037853 Bacteria 5083
105 Ga0436364_0828560 3300037853 Bacteria 1881
106 Ga0436364_0933623 3300037853 Bacteria 1075
107 Ga0400483_093938 3300039062 Bacteria 1947
108 Ga0400483_231907 3300039062 Bacteria 8113
109 Ga0400483_281994 3300039062 Bacteria 5202
110 Ga0436365_0087171 3300039437 Bacteria 1360
111 Ga0436365_0276468 3300039437 Unclassified 609
112 Ga0436365_0813245 3300039437 Bacteria 1436
113 Ga0436365_0866723 3300039437 Bacteria 7947
114 Ga0436360_0219518 3300039438 Bacteria 1735
115 Ga0436360_0418396 3300039438 Bacteria 1015
116 Ga0436360_0977448 3300039438 Bacteria 2024
117 Ga0436360_1047620 3300039438 Bacteria 905
118 Ga0436360_1315034 3300039438 Bacteria 1023
119 Ga0436361_0963349 3300039447 Bacteria 2262
120 Ga0436363_0513640 3300039450 Bacteria 1710
121 Ga0436363_1132597 3300039450 Bacteria 2089
122 Ga0436362_0070316 3300039453 Bacteria 919
123 Ga0436362_0101903 3300039453 Bacteria 1636
124 Ga0436362_0796283 3300039453 Bacteria 1584
125 Ga0436362_0876733 3300039453 Bacteria 1836
126 Ga0436362_0957417 3300039453 Bacteria 760
127 Ga0436362_0959493 3300039453 Bacteria 3764
128 Ga0451791_1354884 3300041451 Bacteria 1253
129 Ga0451797_0773223 3300041453 Bacteria 1906
130 Ga0451807_1223311 3300041486 Bacteria 2336
131 Ga0451576_0016972 3300045051 Bacteria 8017
132 Ga0466967_0960222 3300045976 Bacteria 851
133 Ga0495603_0007260 3300046455 Bacteria 6656
134 Ga0495622_0002845 3300046557 Bacteria 8256
135 Ga0495668_0279119 3300046616 Bacteria 915
136 Ga0495625_0283587 3300046660 Bacteria 1065
137 Ga0495589_0189552 3300046794 Bacteria 973
138 Ga0495672_0035593 3300047320 Bacteria 3066
139 Ga0495679_113153 3300047446 Bacteria 746
140 Ga0496102_0002657 3300048905 Bacteria 15204
141 Ga0496103_0004870 3300048906 Bacteria 8108
142 Ga0496104_0293647 3300048907 Bacteria 1538
143 Ga0496112_0255593 3300048915 Bacteria 1702
144 Ga0496113_0375293 3300048916 Bacteria 1141
145 Ga0496116_0025145 3300048919 Bacteria 4384
146 Ga0496117_0011650 3300048920 Bacteria 7855
147 Ga0496118_0005055 3300048921 Bacteria 15204
148 Ga0496124_0004977 3300048927 Bacteria 15204
149 Ga0501033_0047033 3300049570 Bacteria 3208
150 Ga0501034_0226675 3300049571 Bacteria 1819
151 Ga0501034_0380608 3300049571 Bacteria 1336
152 Ga0501038_0127212 3300049574 Bacteria 2096
153 Ga0501068_0296054 3300049584 Bacteria 1035
154 Ga0501070_0062223 3300049586 Bacteria 3092
155 Ga0501070_0553929 3300049586 Bacteria 920
156 Ga0501073_0260002 3300049589 Bacteria 1198
157 Ga0501080_0118004 3300049742 Bacteria 2459
158 Ga0501083_0119440 3300049744 Bacteria 1730
159 Ga0501035_0133434 3300049822 Bacteria 2163
160 Ga0501044_0042585 3300049823 Bacteria 4721
161 nmdc:mga00v17_77934_c1 3300050491 Bacteria 1523
162 nmdc:mga06r32_416309_c1 3300050510 Bacteria 1325
163 nmdc:mga08y16_936721_c1 3300050511 Bacteria 850
164 nmdc:mga0rr50_116174_c1 3300050513 Bacteria 2124
165 nmdc:mga08x19_489603_c1 3300050514 Bacteria 868
166 Ga0500646_0022772 3300053090 Bacteria 1677
167 Ga0500637_0107257 3300053178 Bacteria 1620
168 Ga0501084_0298077 3300054114 Bacteria 1362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032133 Ga0316583_10011880 Ga0316583_100118803 161
2 3300006175 Ga0070712_100037067 Ga0070712_1000370672 166
3 3300025898 Ga0207692_10266563 Ga0207692_102665632 166
4 3300025928 Ga0207700_10421390 Ga0207700_104213902 166
5 3300025929 Ga0207664_10162827 Ga0207664_101628272 166
6 3300025939 Ga0207665_10099768 Ga0207665_100997683 166
7 3300039437 Ga0436365_0087171 Ga0436365_0087171_598_1122 166
8 3300039438 Ga0436360_0977448 Ga0436360_0977448_184_708 166
9 3300039438 Ga0436360_1047620 Ga0436360_1047620_82_606 166
10 3300039453 Ga0436362_0876733 Ga0436362_0876733_941_1465 166
11 3300009093 Ga0105240_10246131 Ga0105240_102461312 174
12 3300025920 Ga0207649_10000053 Ga0207649_1000005396 174
13 3300026078 Ga0207702_10452129 Ga0207702_104521293 174
14 3300031250 Ga0265331_10000343 Ga0265331_1000034313 174
15 3300031251 Ga0265327_10000105 Ga0265327_1000010597 174
16 3300039062 Ga0400483_231907 Ga0400483_231907_1962_2498 174
17 3300049744 Ga0501083_0119440 Ga0501083_0119440_11_544 174
18 3300054114 Ga0501084_0298077 Ga0501084_0298077_567_1100 174
19 3300039437 Ga0436365_0813245 Ga0436365_0813245_689_1240 175
20 3300009094 Ga0111539_10579905 Ga0111539_105799052 180
21 3300050511 nmdc:mga08y16_936721_c1 nmdc:mga08y16_936721_c1_154_774 180
22 iso_pu_bacteria 2854681122 2854682616 181
23 iso_pu_bacteria 2898795034 2898798525 181
24 iso_pu_bacteria 2919679072 2919681734 181
25 3300039062 Ga0400483_093938 Ga0400483_093938_1124_1708 183
26 3300037853 Ga0436364_0828560 Ga0436364_0828560_354_932 184
27 3300039438 Ga0436360_1315034 Ga0436360_1315034_423_1013 184
28 3300005544 Ga0070686_100031079 Ga0070686_1000310792 185
29 3300031456 Ga0307513_10147845 Ga0307513_101478454 185
30 3300032168 Ga0316593_10079842 Ga0316593_100798422 185
31 3300041451 Ga0451791_1354884 Ga0451791_1354884_210_785 185
32 3300041453 Ga0451797_0773223 Ga0451797_0773223_963_1538 185
33 3300041486 Ga0451807_1223311 Ga0451807_1223311_1110_1685 185
34 3300045051 Ga0451576_0016972 Ga0451576_0016972_2071_2646 185
35 3300045976 Ga0466967_0960222 Ga0466967_0960222_61_630 185
36 3300005335 Ga0070666_10091763 Ga0070666_100917632 186
37 3300005458 Ga0070681_10567061 Ga0070681_105670612 186
38 3300025912 Ga0207707_10607247 Ga0207707_106072472 186
39 3300037853 Ga0436364_0933623 Ga0436364_0933623_68_643 186
40 3300039453 Ga0436362_0101903 Ga0436362_0101903_533_1117 186
41 3300049586 Ga0501070_0553929 Ga0501070_0553929_57_626 186
42 3300005843 Ga0068860_100000680 Ga0068860_10000068017 187
43 3300005844 Ga0068862_100000193 Ga0068862_10000019345 187
44 3300025961 Ga0207712_10000002 Ga0207712_10000002495 187
45 3300026088 Ga0207641_10003745 Ga0207641_100037459 187
46 3300028380 Ga0268265_10000048 Ga0268265_10000048139 187
47 3300028381 Ga0268264_10000304 Ga0268264_1000030417 187
48 3300048905 Ga0496102_0002657 Ga0496102_0002657_3281_3853 187
49 3300048906 Ga0496103_0004870 Ga0496103_0004870_3281_3853 187
50 3300048907 Ga0496104_0293647 Ga0496104_0293647_101_673 187
51 3300048919 Ga0496116_0025145 Ga0496116_0025145_2265_2837 187
52 3300048920 Ga0496117_0011650 Ga0496117_0011650_3281_3853 187
53 3300048921 Ga0496118_0005055 Ga0496118_0005055_3281_3853 187
54 3300048927 Ga0496124_0004977 Ga0496124_0004977_11352_11924 187
55 3300005335 Ga0070666_10056488 Ga0070666_100564882 188
56 3300005337 Ga0070682_100271548 Ga0070682_1002715481 188
57 3300005434 Ga0070709_10223184 Ga0070709_102231841 188
58 3300005435 Ga0070714_100136733 Ga0070714_1001367332 188
59 3300005435 Ga0070714_100150425 Ga0070714_1001504253 188
60 3300005435 Ga0070714_100866179 Ga0070714_1008661791 188
61 3300005436 Ga0070713_100147557 Ga0070713_1001475572 188
62 3300005436 Ga0070713_100433055 Ga0070713_1004330552 188
63 3300005437 Ga0070710_10240931 Ga0070710_102409312 188
64 3300005458 Ga0070681_10602280 Ga0070681_106022802 188
65 3300005467 Ga0070706_100290517 Ga0070706_1002905172 188
66 3300005471 Ga0070698_100031592 Ga0070698_1000315927 188
67 3300005471 Ga0070698_100646571 Ga0070698_1006465711 188
68 3300005530 Ga0070679_100716749 Ga0070679_1007167492 188
69 3300005614 Ga0068856_100526707 Ga0068856_1005267072 188
70 3300006028 Ga0070717_10012961 Ga0070717_100129618 188
71 3300006028 Ga0070717_10170248 Ga0070717_101702482 188
72 3300006028 Ga0070717_10393710 Ga0070717_103937102 188
73 3300006175 Ga0070712_100033693 Ga0070712_1000336934 188
74 3300006175 Ga0070712_100172139 Ga0070712_1001721392 188
75 3300006175 Ga0070712_100239552 Ga0070712_1002395522 188
76 3300006175 Ga0070712_100535398 Ga0070712_1005353982 188
77 3300007076 Ga0075435_100234520 Ga0075435_1002345202 188
78 3300007788 Ga0099795_10023091 Ga0099795_100230912 188
79 3300009094 Ga0111539_10269421 Ga0111539_102694212 188
80 3300010159 Ga0099796_10251880 Ga0099796_102518802 188
81 3300014497 Ga0182008_10088973 Ga0182008_100889732 188
82 3300014968 Ga0157379_10328561 Ga0157379_103285612 188
83 3300021358 Ga0213873_10022443 Ga0213873_100224433 188
84 3300021384 Ga0213876_10023996 Ga0213876_100239963 188
85 3300021388 Ga0213875_10001688 Ga0213875_100016888 188
86 3300021388 Ga0213875_10062299 Ga0213875_100622993 188
87 3300021388 Ga0213875_10112801 Ga0213875_101128013 188
88 3300025898 Ga0207692_10107984 Ga0207692_101079842 188
89 3300025903 Ga0207680_10036025 Ga0207680_100360252 188
90 3300025906 Ga0207699_10137062 Ga0207699_101370623 188
91 3300025906 Ga0207699_10198950 Ga0207699_101989502 188
92 3300025906 Ga0207699_10695661 Ga0207699_106956611 188
93 3300025915 Ga0207693_10036288 Ga0207693_100362883 188
94 3300025915 Ga0207693_10060261 Ga0207693_100602614 188
95 3300025915 Ga0207693_10211460 Ga0207693_102114602 188
96 3300025916 Ga0207663_10079994 Ga0207663_100799943 188
97 3300025921 Ga0207652_10592135 Ga0207652_105921352 188
98 3300025928 Ga0207700_10131134 Ga0207700_101311342 188
99 3300025928 Ga0207700_10252782 Ga0207700_102527822 188
100 3300025928 Ga0207700_10840989 Ga0207700_108409892 188
101 3300025929 Ga0207664_10611102 Ga0207664_106111022 188
102 3300025931 Ga0207644_10606507 Ga0207644_106065071 188
103 3300025936 Ga0207670_10254451 Ga0207670_102544511 188
104 3300025944 Ga0207661_10481727 Ga0207661_104817271 188
105 3300026035 Ga0207703_10544275 Ga0207703_105442751 188
106 3300026078 Ga0207702_10085635 Ga0207702_100856354 188
107 3300026095 Ga0207676_10563281 Ga0207676_105632812 188
108 3300028379 Ga0268266_10463604 Ga0268266_104636041 188
109 3300028381 Ga0268264_10601925 Ga0268264_106019252 188
110 3300035089 Ga0373944_0149776 Ga0373944_0149776_128_724 188
111 3300035115 Ga0373941_0008575 Ga0373941_0008575_992_1579 188
112 3300035116 Ga0373945_0233493 Ga0373945_0233493_134_724 188
113 3300035121 Ga0373960_0037308 Ga0373960_0037308_709_1296 188
114 3300035691 Ga0373931_0071185 Ga0373931_0071185_88_675 188
115 3300035725 Ga0373947_0043978 Ga0373947_0043978_2060_2650 188
116 3300036401 Ga0373937_0394325 Ga0373937_0394325_132_722 188
117 3300037418 Ga0395900_0316621 Ga0395900_0316621_204_809 188
118 3300037418 Ga0395900_0833884 Ga0395900_0833884_201_776 188
119 3300037466 Ga0395898_0607862 Ga0395898_0607862_53_658 188
120 3300037853 Ga0436364_0505500 Ga0436364_0505500_456_1046 188
121 3300037853 Ga0436364_0541917 Ga0436364_0541917_804_1400 188
122 3300039437 Ga0436365_0276468 Ga0436365_0276468_10_588 188
123 3300039437 Ga0436365_0866723 Ga0436365_0866723_2701_3288 188
124 3300039438 Ga0436360_0219518 Ga0436360_0219518_571_1167 188
125 3300039438 Ga0436360_0418396 Ga0436360_0418396_59_658 188
126 3300039447 Ga0436361_0963349 Ga0436361_0963349_852_1448 188
127 3300039450 Ga0436363_0513640 Ga0436363_0513640_475_1071 188
128 3300039450 Ga0436363_1132597 Ga0436363_1132597_217_813 188
129 3300039453 Ga0436362_0070316 Ga0436362_0070316_277_867 188
130 3300039453 Ga0436362_0796283 Ga0436362_0796283_656_1252 188
131 3300039453 Ga0436362_0957417 Ga0436362_0957417_104_715 188
132 3300039453 Ga0436362_0959493 Ga0436362_0959493_1657_2244 188
133 3300048915 Ga0496112_0255593 Ga0496112_0255593_171_758 188
134 3300048916 Ga0496113_0375293 Ga0496113_0375293_242_829 188
135 3300049571 Ga0501034_0380608 Ga0501034_0380608_618_1190 188
136 3300050513 nmdc:mga0rr50_116174_c1 nmdc:mga0rr50_116174_c1_1486_2073 188
137 3300050514 nmdc:mga08x19_489603_c1 nmdc:mga08x19_489603_c1_121_708 188
138 3300046794 Ga0495589_0189552 Ga0495589_0189552_367_963 189
139 3300053178 Ga0500637_0107257 Ga0500637_0107257_22_618 189
140 3300005471 Ga0070698_100807581 Ga0070698_1008075811 190
141 3300006844 Ga0075428_100058427 Ga0075428_1000584272 190
142 3300039062 Ga0400483_281994 Ga0400483_281994_117_707 190
143 3300050510 nmdc:mga06r32_416309_c1 nmdc:mga06r32_416309_c1_688_1296 190
144 3300009553 Ga0105249_10000002 Ga0105249_10000002123 191
145 3300050491 nmdc:mga00v17_77934_c1 nmdc:mga00v17_77934_c1_389_991 192
146 3300005719 Ga0068861_100230518 Ga0068861_1002305183 193
147 3300005844 Ga0068862_100055079 Ga0068862_1000550792 193
148 3300026118 Ga0207675_100273557 Ga0207675_1002735573 193
149 3300046455 Ga0495603_0007260 Ga0495603_0007260_3662_4285 193
150 3300046557 Ga0495622_0002845 Ga0495622_0002845_2495_3118 193
151 3300046616 Ga0495668_0279119 Ga0495668_0279119_167_790 193
152 3300046660 Ga0495625_0283587 Ga0495625_0283587_319_942 193
153 3300047320 Ga0495672_0035593 Ga0495672_0035593_857_1480 193
154 3300047446 Ga0495679_113153 Ga0495679_113153_90_713 193
155 3300053090 Ga0500646_0022772 Ga0500646_0022772_608_1231 193
156 3300005841 Ga0068863_101215800 Ga0068863_1012158001 196
157 3300005344 Ga0070661_100000164 Ga0070661_10000016442 198
158 3300025913 Ga0207695_10280963 Ga0207695_102809632 198
159 3300031250 Ga0265331_10000020 Ga0265331_1000002024 198
160 3300031711 Ga0265314_10007136 Ga0265314_100071365 198
161 3300031711 Ga0265314_10099579 Ga0265314_100995792 198
162 3300049570 Ga0501033_0047033 Ga0501033_0047033_2053_2685 198
163 3300049571 Ga0501034_0226675 Ga0501034_0226675_607_1239 198
164 3300049574 Ga0501038_0127212 Ga0501038_0127212_1056_1688 198
165 3300049584 Ga0501068_0296054 Ga0501068_0296054_226_858 198
166 3300049586 Ga0501070_0062223 Ga0501070_0062223_2296_2928 198
167 3300049589 Ga0501073_0260002 Ga0501073_0260002_519_1151 198
168 3300049742 Ga0501080_0118004 Ga0501080_0118004_270_902 198
169 3300049822 Ga0501035_0133434 Ga0501035_0133434_1334_1966 198
170 3300049823 Ga0501044_0042585 Ga0501044_0042585_431_1063 198
171 3300003322 rootL2_10327431 rootL2_103274312 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02545

Maf

Maf-like protein

8

197

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9314 11 205
1exc-assembly1.cif.gz_A crystal structure of b. subtilis maf protein complexed with d-(utp) 0.9261 11 205
4heb-assembly1.cif.gz_A the crystal structure of maf protein of bacillus subtilis 0.9167 11 205
4p0e-assembly1.cif.gz_A yhde e33a (p212121 space group) 0.9125 12 206
4heb-assembly1.cif.gz_B the crystal structure of maf protein of bacillus subtilis 0.9044 11 206
ID Description Score Start End Superfamily
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9348 12 206 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9314 11 205 3.90.950.10
4hebA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9167 11 205 3.90.950.10
4p0uA00 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9107 12 206 3.90.950.10
af_Q55G28_10_210_3.90.950.10 Alpha Beta;Alpha-Beta Complex;Maf protein; 0.9023 11 205 3.90.950.10
ID Description Score Start End GO Terms
AF-A0A2R8BNH1-F1-model_v4 Maf-like protein YhdE 0.9678 74 205 GO:0009117
GO:0047429
AF-A0A3B9GZ81-F1-model_v4 Septum formation inhibitor Maf 0.9661 77 205 GO:0009117
GO:0047429
AF-D2U2L5-F1-model_v4 Inhibitor of septum formation 0.9529 77 206 GO:0009117
GO:0047429
AF-A0A3B9R1L6-F1-model_v4 Septum formation inhibitor Maf 0.9504 77 205 GO:0009117
GO:0047429
AF-A0A1H0CMG7-F1-model_v4 dTTP/UTP pyrophosphatase (dTTPase/UTPase) (EC 3.6.1.9) (Nucleoside triphosphate pyrophosphatase) (Nucleotide pyrophosphatase) (Nucleotide PPase) 0.9498 11 206 GO:0005737
GO:0009117
GO:0036218
GO:0036221
GO:0106379

Feature Viewer

pLDDT pTM Quality
89.29 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map