F258677

General Info

Members Datasets Scaffolds Average Seq Length
171 127 342 237

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10122771|Ga0114129_101227712
Length 269
Sequence MQSRPGKQRSARQEADVNSTKQQARVAGFLYLVLALIAPIGLLYVPGKLIVSGNATATADNIRASEWLLRIGIASELIHQVIAVFLVLALYRLFKAVNEAHAKQMVILGALVSVPIMFINVLNEIAALILVSGADFLSVFEKPQLDALAYLFFRLHGQGFAVASIFWGLWLFPFGMLVIRSGFIPRVLGVLLMIAGVAYLANAFATFILPRYAPLVSQVALPLEGAELPIVFWLLIWGVKRRPTDAPPPRGTWFLRRRDLPLGRSRRDA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
85 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
86 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
87 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
102 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
111 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
112 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
125 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 0
Rhizosphere 96.49
Stem 0
Stem Tuber 0
Unclassified 21.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10122771 3300009147 Bacteria 3574
2 rootH1_10181397 3300003316 Bacteria 1746
3 rootH1_10214729 3300003323 Bacteria 2824
4 Ga0065704_10303429 3300005289 Unclassified 881
5 Ga0065715_10005746 3300005293 Bacteria 3248
6 Ga0070676_10013379 3300005328 Bacteria 4496
7 Ga0070690_100075260 3300005330 Bacteria 2201
8 Ga0070677_10026238 3300005333 Bacteria 2183
9 Ga0068868_100062788 3300005338 Bacteria 2946
10 Ga0070689_100019168 3300005340 Bacteria 5055
11 Ga0070687_100096468 3300005343 Bacteria 1646
12 Ga0070687_100103988 3300005343 Unclassified 1595
13 Ga0070687_100346186 3300005343 Unclassified 958
14 Ga0070673_100111164 3300005364 Bacteria 2272
15 Ga0070714_100228044 3300005435 Bacteria 1715
16 Ga0070713_100267760 3300005436 Unclassified 1564
17 Ga0070701_10013101 3300005438 Bacteria 3762
18 Ga0070701_10310996 3300005438 Unclassified 972
19 Ga0070711_100088183 3300005439 Bacteria 2229
20 Ga0070711_100150304 3300005439 Bacteria 1755
21 Ga0070700_100000028 3300005441 Bacteria 121783
22 Ga0070708_100140835 3300005445 Unclassified 2236
23 Ga0070708_100619168 3300005445 Bacteria 1020
24 Ga0070662_100095953 3300005457 Bacteria 2236
25 Ga0068867_100048429 3300005459 Bacteria 3126
26 Ga0070685_10068211 3300005466 Bacteria 2100
27 Ga0070706_100004141 3300005467 Bacteria 14101
28 Ga0070706_100009345 3300005467 Bacteria 9132
29 Ga0070706_100123558 3300005467 Bacteria 2413
30 Ga0070706_100323439 3300005467 Unclassified 1438
31 Ga0070706_100375885 3300005467 Unclassified 1323
32 Ga0070707_100015576 3300005468 Bacteria 7135
33 Ga0070707_100037923 3300005468 Unclassified 4602
34 Ga0070707_100264910 3300005468 Unclassified 1671
35 Ga0070698_100039312 3300005471 Unclassified 4871
36 Ga0070697_100012760 3300005536 Bacteria 6581
37 Ga0070697_100034803 3300005536 Bacteria 4062
38 Ga0070697_100230045 3300005536 Unclassified 1581
39 Ga0070697_100856121 3300005536 Unclassified 805
40 Ga0070686_100032172 3300005544 Bacteria 3213
41 Ga0070696_100000565 3300005546 Bacteria 23583
42 Ga0070696_100288940 3300005546 Bacteria 1252
43 Ga0070665_100013360 3300005548 Bacteria 8265
44 Ga0070704_100033393 3300005549 Unclassified 3478
45 Ga0070704_100730227 3300005549 Unclassified 880
46 Ga0070702_100363936 3300005615 Bacteria 1023
47 Ga0068852_100199929 3300005616 Bacteria 1891
48 Ga0068863_100023686 3300005841 Bacteria 5859
49 Ga0068860_100065081 3300005843 Bacteria 3462
50 Ga0070717_10015358 3300006028 Bacteria 5914
51 Ga0070716_100057161 3300006173 Bacteria 2241
52 Ga0070716_100120927 3300006173 Bacteria 1639
53 Ga0070712_100033525 3300006175 Bacteria 3476
54 Ga0075428_100000473 3300006844 Bacteria 40394
55 Ga0075428_100009741 3300006844 Bacteria 10674
56 Ga0075430_100022156 3300006846 Bacteria 5401
57 Ga0075430_100025571 3300006846 Bacteria 5024
58 Ga0075431_100041310 3300006847 Bacteria 4754
59 Ga0075431_100320816 3300006847 Bacteria 1562
60 Ga0075433_10037427 3300006852 Bacteria 4186
61 Ga0075433_10051569 3300006852 Bacteria 3583
62 Ga0075433_10104052 3300006852 Unclassified 2515
63 Ga0075433_10782243 3300006852 Bacteria 834
64 Ga0075434_100002996 3300006871 Bacteria 15029
65 Ga0075434_100034111 3300006871 Bacteria 5024
66 Ga0075429_100016031 3300006880 Bacteria 6491
67 Ga0068865_100019175 3300006881 Bacteria 4424
68 Ga0111539_10104577 3300009094 Bacteria 3322
69 Ga0105247_10033086 3300009101 Bacteria 3144
70 Ga0114129_10047118 3300009147 Bacteria 6058
71 Ga0105243_10016429 3300009148 Bacteria 5598
72 Ga0105242_10104680 3300009176 Unclassified 2402
73 Ga0105242_10317015 3300009176 Bacteria 1429
74 Ga0105248_10012086 3300009177 Bacteria 9525
75 Ga0105249_10194678 3300009553 Unclassified 1980
76 Ga0157374_10074254 3300013296 Bacteria 3211
77 Ga0157378_10016230 3300013297 Bacteria 6523
78 Ga0157372_10565817 3300013307 Unclassified 1325
79 Ga0157375_10330583 3300013308 Unclassified 1689
80 Ga0157375_10650230 3300013308 Bacteria 1211
81 Ga0157380_10087371 3300014326 Bacteria 2563
82 Ga0182008_10260512 3300014497 Bacteria 897
83 Ga0213872_10177151 3300021361 Bacteria 922
84 Ga0207642_10311320 3300025899 Unclassified 916
85 Ga0207710_10099379 3300025900 Bacteria 1370
86 Ga0207645_10030434 3300025907 Bacteria 3478
87 Ga0207684_10001447 3300025910 Bacteria 25658
88 Ga0207684_10050764 3300025910 Bacteria 3519
89 Ga0207684_10148108 3300025910 Bacteria 2019
90 Ga0207684_10261686 3300025910 Bacteria 1493
91 Ga0207684_10560812 3300025910 Unclassified 977
92 Ga0207693_10125478 3300025915 Bacteria 2017
93 Ga0207693_10158054 3300025915 Unclassified 1783
94 Ga0207663_10030003 3300025916 Bacteria 3202
95 Ga0207662_10033116 3300025918 Bacteria 3010
96 Ga0207662_10033416 3300025918 Bacteria 2998
97 Ga0207646_10012039 3300025922 Bacteria 8332
98 Ga0207646_10024571 3300025922 Bacteria 5519
99 Ga0207646_10250444 3300025922 Unclassified 1600
100 Ga0207646_10527831 3300025922 Unclassified 1062
101 Ga0207659_10143081 3300025926 Bacteria 1858
102 Ga0207700_10121475 3300025928 Unclassified 2119
103 Ga0207664_10297425 3300025929 Bacteria 1419
104 Ga0207686_10130263 3300025934 Unclassified 1724
105 Ga0207670_10161588 3300025936 Bacteria 1672
106 Ga0207704_10010843 3300025938 Bacteria 4463
107 Ga0207665_10119590 3300025939 Bacteria 1860
108 Ga0207691_10095353 3300025940 Bacteria 2661
109 Ga0207651_10282410 3300025960 Bacteria 1373
110 Ga0207712_10278702 3300025961 Bacteria 1364
111 Ga0207703_10109183 3300026035 Bacteria 2357
112 Ga0207708_10000035 3300026075 Bacteria 140227
113 Ga0207641_10015752 3300026088 Bacteria 6194
114 Ga0207648_10061293 3300026089 Bacteria 3280
115 Ga0207675_100171000 3300026118 Bacteria 2077
116 Ga0207698_10180413 3300026142 Bacteria 1870
117 Ga0209588_1015749 3300027671 Bacteria 2327
118 Ga0209974_10032596 3300027876 Bacteria 1727
119 Ga0268265_10032492 3300028380 Bacteria 3783
120 Ga0265326_10012963 3300028558 Bacteria 2443
121 Ga0265319_1011337 3300028563 Unclassified 3655
122 Ga0265334_10071833 3300028573 Bacteria 1288
123 Ga0265318_10024200 3300028577 Bacteria 2412
124 Ga0265323_10001132 3300028653 Bacteria 13730
125 Ga0265322_10002112 3300028654 Bacteria 6222
126 Ga0307517_10297169 3300028786 Bacteria 908
127 Ga0265338_10063205 3300028800 Bacteria 3229
128 Ga0265324_10012195 3300029957 Unclassified 3250
129 Ga0265330_10005307 3300031235 Bacteria 6420
130 Ga0265332_10002823 3300031238 Bacteria 8618
131 Ga0265328_10013063 3300031239 Unclassified 3293
132 Ga0265320_10002284 3300031240 Bacteria 13439
133 Ga0265329_10004236 3300031242 Bacteria 6024
134 Ga0265340_10041509 3300031247 Unclassified 2261
135 Ga0265339_10002486 3300031249 Bacteria 13171
136 Ga0265331_10008534 3300031250 Bacteria 5822
137 Ga0265316_10004024 3300031344 Bacteria 14719
138 Ga0307513_10020603 3300031456 Bacteria 7814
139 Ga0307513_10106672 3300031456 Bacteria 2807
140 Ga0307408_100019375 3300031548 Bacteria 4581
141 Ga0265314_10038864 3300031711 Bacteria 3434
142 Ga0265342_10001333 3300031712 Bacteria 23160
143 Ga0265342_10150725 3300031712 Bacteria 1291
144 Ga0307412_10423012 3300031911 Bacteria 1090
145 Ga0373931_0253869 3300035691 Bacteria 1070
146 Ga0373935_0011618 3300035692 Bacteria 5289
147 Ga0373947_0198133 3300035725 Unclassified 1313
148 Ga0436361_1154271 3300039447 Bacteria 2403
149 Ga0495582_0006803 3300046473 Bacteria 6363
150 Ga0495632_0175262 3300046519 Bacteria 984
151 Ga0495622_0136029 3300046557 Bacteria 1117
152 Ga0495625_0035213 3300046660 Bacteria 3691
153 Ga0495615_0011487 3300048090 Bacteria 1801
154 Ga0501036_0465371 3300049572 Bacteria 1053
155 Ga0501041_0229246 3300049577 Bacteria 1166
156 Ga0501074_0259082 3300049590 Unclassified 1237
157 Ga0501076_0298305 3300049592 Unclassified 1321
158 nmdc:mga05p37_265323_c1 3300050507 Bacteria 2053
159 nmdc:mga09592_4687_c1 3300050508 Bacteria 11067
160 nmdc:mga06r32_10201_c1 3300050510 Bacteria 8480
161 nmdc:mga06r32_267109_c1 3300050510 Bacteria 1698
162 nmdc:mga06r32_668287_c1 3300050510 Unclassified 1006
163 nmdc:mga08y16_148087_c1 3300050511 Bacteria 2440
164 nmdc:mga0n895_164262_c1 3300050512 Bacteria 2252
165 nmdc:mga0n895_2221_c1 3300050512 Bacteria 15005
166 nmdc:mga0rr50_72827_c1 3300050513 Bacteria 2625
167 nmdc:mga0a205_17056_c1 3300050515 Bacteria 6798
168 nmdc:mga0a205_192367_c1 3300050515 Unclassified 1932
169 nmdc:mga0a205_471073_c1 3300050515 Bacteria 1115
170 nmdc:mga0a205_65658_c1 3300050515 Unclassified 3506
171 Ga0500637_0041155 3300053178 Bacteria 2612
172 Ga0114129_10122771
173 rootH1_10181397
174 rootH1_10214729
175 Ga0065704_10303429
176 Ga0065715_10005746
177 Ga0070676_10013379
178 Ga0070690_100075260
179 Ga0070677_10026238
180 Ga0068868_100062788
181 Ga0070689_100019168
182 Ga0070687_100096468
183 Ga0070687_100103988
184 Ga0070687_100346186
185 Ga0070673_100111164
186 Ga0070714_100228044
187 Ga0070713_100267760
188 Ga0070701_10013101
189 Ga0070701_10310996
190 Ga0070711_100088183
191 Ga0070711_100150304
192 Ga0070700_100000028
193 Ga0070708_100140835
194 Ga0070708_100619168
195 Ga0070662_100095953
196 Ga0068867_100048429
197 Ga0070685_10068211
198 Ga0070706_100004141
199 Ga0070706_100009345
200 Ga0070706_100123558
201 Ga0070706_100323439
202 Ga0070706_100375885
203 Ga0070707_100015576
204 Ga0070707_100037923
205 Ga0070707_100264910
206 Ga0070698_100039312
207 Ga0070697_100012760
208 Ga0070697_100034803
209 Ga0070697_100230045
210 Ga0070697_100856121
211 Ga0070686_100032172
212 Ga0070696_100000565
213 Ga0070696_100288940
214 Ga0070665_100013360
215 Ga0070704_100033393
216 Ga0070704_100730227
217 Ga0070702_100363936
218 Ga0068852_100199929
219 Ga0068863_100023686
220 Ga0068860_100065081
221 Ga0070717_10015358
222 Ga0070716_100057161
223 Ga0070716_100120927
224 Ga0070712_100033525
225 Ga0075428_100000473
226 Ga0075428_100009741
227 Ga0075430_100022156
228 Ga0075430_100025571
229 Ga0075431_100041310
230 Ga0075431_100320816
231 Ga0075433_10037427
232 Ga0075433_10051569
233 Ga0075433_10104052
234 Ga0075433_10782243
235 Ga0075434_100002996
236 Ga0075434_100034111
237 Ga0075429_100016031
238 Ga0068865_100019175
239 Ga0111539_10104577
240 Ga0105247_10033086
241 Ga0114129_10047118
242 Ga0105243_10016429
243 Ga0105242_10104680
244 Ga0105242_10317015
245 Ga0105248_10012086
246 Ga0105249_10194678
247 Ga0157374_10074254
248 Ga0157378_10016230
249 Ga0157372_10565817
250 Ga0157375_10330583
251 Ga0157375_10650230
252 Ga0157380_10087371
253 Ga0182008_10260512
254 Ga0213872_10177151
255 Ga0207642_10311320
256 Ga0207710_10099379
257 Ga0207645_10030434
258 Ga0207684_10001447
259 Ga0207684_10050764
260 Ga0207684_10148108
261 Ga0207684_10261686
262 Ga0207684_10560812
263 Ga0207693_10125478
264 Ga0207693_10158054
265 Ga0207663_10030003
266 Ga0207662_10033116
267 Ga0207662_10033416
268 Ga0207646_10012039
269 Ga0207646_10024571
270 Ga0207646_10250444
271 Ga0207646_10527831
272 Ga0207659_10143081
273 Ga0207700_10121475
274 Ga0207664_10297425
275 Ga0207686_10130263
276 Ga0207670_10161588
277 Ga0207704_10010843
278 Ga0207665_10119590
279 Ga0207691_10095353
280 Ga0207651_10282410
281 Ga0207712_10278702
282 Ga0207703_10109183
283 Ga0207708_10000035
284 Ga0207641_10015752
285 Ga0207648_10061293
286 Ga0207675_100171000
287 Ga0207698_10180413
288 Ga0209588_1015749
289 Ga0209974_10032596
290 Ga0268265_10032492
291 Ga0265326_10012963
292 Ga0265319_1011337
293 Ga0265334_10071833
294 Ga0265318_10024200
295 Ga0265323_10001132
296 Ga0265322_10002112
297 Ga0307517_10297169
298 Ga0265338_10063205
299 Ga0265324_10012195
300 Ga0265330_10005307
301 Ga0265332_10002823
302 Ga0265328_10013063
303 Ga0265320_10002284
304 Ga0265329_10004236
305 Ga0265340_10041509
306 Ga0265339_10002486
307 Ga0265331_10008534
308 Ga0265316_10004024
309 Ga0307513_10020603
310 Ga0307513_10106672
311 Ga0307408_100019375
312 Ga0265314_10038864
313 Ga0265342_10001333
314 Ga0265342_10150725
315 Ga0307412_10423012
316 Ga0373931_0253869
317 Ga0373935_0011618
318 Ga0373947_0198133
319 Ga0436361_1154271
320 Ga0495582_0006803
321 Ga0495632_0175262
322 Ga0495622_0136029
323 Ga0495625_0035213
324 Ga0495615_0011487
325 Ga0501036_0465371
326 Ga0501041_0229246
327 Ga0501074_0259082
328 Ga0501076_0298305
329 nmdc:mga05p37_265323_c1
330 nmdc:mga09592_4687_c1
331 nmdc:mga06r32_10201_c1
332 nmdc:mga06r32_267109_c1
333 nmdc:mga06r32_668287_c1
334 nmdc:mga08y16_148087_c1
335 nmdc:mga0n895_164262_c1
336 nmdc:mga0n895_2221_c1
337 nmdc:mga0rr50_72827_c1
338 nmdc:mga0a205_17056_c1
339 nmdc:mga0a205_192367_c1
340 nmdc:mga0a205_471073_c1
341 nmdc:mga0a205_65658_c1
342 Ga0500637_0041155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14329

DUF4386

Domain of unknown function (DUF4386)

26

238

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6aki-assembly2.cif.gz_P calcium release-activated calcium channel protein 1, p288l mutant 0.4646 142 234
8b6j-assembly1.cif.gz_c cryo-em structure of cytochrome bc1 complex (complex-iii) from respiratory supercomplex of tetrahymena thermophila 0.461 1 170
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.4377 8 158
8pp5-assembly1.cif.gz_E unitary crystal structure of positively supercharged ferritin variant ftn(pos)-m1 (mg formate condition) 0.3763 4 138
5jkl-assembly1.cif.gz_B binary crystal structure of positively and negatively supercharged variants ftn(pos) and ftn(neg) from human heavy chain ferritin (mg formate condition) 0.3696 4 136
ID Description Score Start End Superfamily
af_Q2AAC4_1_138_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6223 144 216 1.20.1070.10
af_Q7JR72_54_280_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5244 3 204 1.20.120.1770
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5196 4 155 1.20.120.1770
af_B5DEF4_7_226_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5005 12 219 1.20.1070.10
af_Q8IE80_1_303_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4881 7 222 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A833HGT4-F1-model_v4 DUF4386 domain-containing protein 0.9838 5 231 GO:0016020
AF-A0A2W5YN28-F1-model_v4 DUF4386 domain-containing protein 0.9798 1 226 GO:0016020
AF-A0A7T9CJ80-F1-model_v4 deleted 0.9771 1 227
AF-A0A535NID6-F1-model_v4 DUF4386 domain-containing protein 0.9759 1 227 GO:0016020
AF-A0A2V9QX43-F1-model_v4 DUF4386 domain-containing protein 0.9758 5 229 GO:0016020

Map