F258560

General Info

Members Datasets Scaffolds Average Seq Length
171 142 342 168

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100015573|Ga0075431_1000155738
Length 179
Sequence MAASEPTSAYILEPLAPSHDRSGFKSGVEPLDRYFSTQVTQDIRRRVSACFVAVERASGTVAGFYTIAASSVPLLDIATATAKKLPRYPLVPAVRVGRLAVAESHRGRRLGAALLADAIDRALRSEIAAFAIVVDAKDDAAAAFYKHYGFIPFASEPMSLYLPLGDVARARGLKLSDAG

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
23 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
24 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
25 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
33 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
50 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
58 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
59 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
60 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
61 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
62 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
63 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
64 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
65 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
66 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
67 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
72 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
73 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
74 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
75 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
96 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
97 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
98 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
105 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
106 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
107 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
108 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
109 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
110 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
111 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
112 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
113 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
114 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
115 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
116 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
117 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
118 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
119 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
120 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
121 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
122 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
123 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
124 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
125 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
126 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
127 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
128 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
129 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
130 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
131 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
132 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
133 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
134 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
135 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
136 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
137 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
138 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
139 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
140 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
141 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
142 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.87
Metatranscriptomes 0.58
Isolates 17.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.7
Nodule 14.62
Rhizoplane 0.58
Rhizosphere 61.99
Stem 0
Stem Tuber 0
Unclassified 11.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100015573 3300006847 Bacteria 7706
2 JGI25151J46595_10067585 3300003187 Bacteria 1101
3 Ga0055524_1040308 3300003775 Bacteria 1193
4 Ga0055531_10030663 3300003794 Bacteria 1799
5 Ga0070683_100221752 3300005329 Bacteria 1797
6 Ga0070661_100282069 3300005344 Bacteria 1289
7 Ga0070700_100959985 3300005441 Unclassified 700
8 Ga0070706_100716381 3300005467 Unclassified 928
9 Ga0070679_100582319 3300005530 Bacteria 1063
10 Ga0070679_100843960 3300005530 Unclassified 859
11 Ga0070684_100032227 3300005535 Bacteria 4466
12 Ga0070684_100547902 3300005535 Bacteria 1073
13 Ga0068853_100268893 3300005539 Bacteria 1569
14 Ga0070665_100017051 3300005548 Bacteria 7285
15 Ga0068854_100093679 3300005578 Bacteria 2239
16 Ga0068856_100000020 3300005614 Bacteria 146775
17 Ga0068856_100116128 3300005614 Bacteria 2677
18 Ga0075367_10006670 3300006178 Bacteria 5853
19 Ga0075428_100749461 3300006844 Bacteria 1039
20 Ga0068865_100244486 3300006881 Unclassified 1413
21 Ga0099795_10013609 3300007788 Bacteria 2501
22 Ga0099795_10027279 3300007788 Bacteria 1931
23 Ga0099795_10048628 3300007788 Bacteria 1536
24 Ga0105240_10149774 3300009093 Bacteria 2781
25 Ga0105240_10490060 3300009093 Unclassified 1369
26 Ga0114129_11468789 3300009147 Unclassified 839
27 Ga0105241_10146319 3300009174 Unclassified 1928
28 Ga0105241_11010930 3300009174 Bacteria 778
29 Ga0105242_11899953 3300009176 Unclassified 636
30 Ga0105237_10027711 3300009545 Bacteria 5777
31 Ga0105237_10099790 3300009545 Unclassified 2895
32 Ga0105237_10625095 3300009545 Bacteria 1084
33 Ga0105238_10008677 3300009551 Bacteria 10170
34 Ga0105238_10017327 3300009551 Bacteria 7320
35 Ga0105238_10420699 3300009551 Bacteria 1331
36 Ga0105238_11545563 3300009551 Unclassified 693
37 Ga0099796_10070761 3300010159 Bacteria 1259
38 Ga0105239_10012339 3300010375 Bacteria 9516
39 Ga0105239_10016757 3300010375 Bacteria 8100
40 Ga0157369_10059399 3300013105 Bacteria 4123
41 Ga0157372_10753507 3300013307 Bacteria 1132
42 Ga0157379_12069583 3300014968 Bacteria 564
43 Ga0157376_10561485 3300014969 Bacteria 1131
44 Ga0209148_1007640 3300025254 Bacteria 2228
45 Ga0209129_1046020 3300025258 Bacteria 677
46 Ga0209025_1001729 3300025294 Bacteria 26362
47 Ga0209758_1013131 3300025297 Bacteria 4551
48 Ga0209257_1012683 3300025304 Bacteria 3859
49 Ga0207684_10875313 3300025910 Unclassified 756
50 Ga0207671_10405451 3300025914 Bacteria 1084
51 Ga0207652_10500736 3300025921 Bacteria 1094
52 Ga0207694_10033195 3300025924 Unclassified 3954
53 Ga0207694_10378032 3300025924 Bacteria 1175
54 Ga0207711_10842225 3300025941 Unclassified 854
55 Ga0207661_10146578 3300025944 Bacteria 2037
56 Ga0207640_10027537 3300025981 Bacteria 3464
57 Ga0207703_10564983 3300026035 Unclassified 1074
58 Ga0207702_10002142 3300026078 Bacteria 18978
59 Ga0207702_10746520 3300026078 Bacteria 966
60 Ga0209179_1013790 3300027512 Bacteria 1474
61 Ga0209179_1050976 3300027512 Bacteria 887
62 Ga0268266_10132834 3300028379 Bacteria 2227
63 Ga0307513_10488673 3300031456 Bacteria 950
64 Ga0265314_10099962 3300031711 Bacteria 1867
65 Ga0373932_0102954 3300035112 Bacteria 931
66 Ga0373937_0913014 3300036401 Bacteria 827
67 Ga0395900_0008833 3300037418 Bacteria 10350
68 Ga0395900_0227624 3300037418 Bacteria 1877
69 Ga0395900_0307896 3300037418 Bacteria 1568
70 Ga0395898_0752086 3300037466 Unclassified 916
71 Ga0395898_1427734 3300037466 Bacteria 619
72 Ga0395905_0007436 3300037471 Bacteria 10891
73 Ga0436364_1289747 3300037853 Bacteria 11395
74 Ga0395901_0014654 3300038443 Bacteria 7968
75 Ga0395901_0024628 3300038443 Bacteria 6180
76 Ga0436365_0806583 3300039437 Bacteria 1024
77 Ga0451833_0162805 3300041491 Bacteria 11155
78 Ga0451835_0575654 3300041492 Bacteria 1649
79 Ga0451839_0497902 3300041496 Bacteria 3288
80 Ga0451845_0136441 3300041501 Bacteria 3252
81 Ga0451846_57984 3300041502 Bacteria 1280
82 Ga0451847_0498903 3300041503 Bacteria 2820
83 Ga0451849_0859084 3300041505 Bacteria 2655
84 Ga0451843_1614029 3300041509 Bacteria 671
85 Ga0451843_1666585 3300041509 Bacteria 2340
86 Ga0451855_1128571 3300041511 Bacteria 1875
87 Ga0451853_2116920 3300041512 Bacteria 2010
88 Ga0453684_0588249 3300044712 Bacteria 1221
89 Ga0466960_0063576 3300044901 Bacteria 1817
90 Ga0495592_0259809 3300046454 Bacteria 1144
91 Ga0495638_0000683 3300046460 Bacteria 36875
92 Ga0495585_0037717 3300046492 Bacteria 2721
93 Ga0495606_0268915 3300046507 Bacteria 937
94 Ga0495631_0023596 3300046518 Bacteria 2850
95 Ga0495648_0019481 3300046524 Bacteria 4770
96 Ga0495654_0164997 3300046530 Bacteria 970
97 Ga0495622_0007146 3300046557 Bacteria 5188
98 Ga0495668_0057413 3300046616 Bacteria 2148
99 Ga0495661_0271931 3300046665 Bacteria 857
100 Ga0495671_0053075 3300046692 Bacteria 2013
101 Ga0495600_0008814 3300046809 Bacteria 6210
102 Ga0495604_0070739 3300047317 Bacteria 2641
103 Ga0495672_0016736 3300047320 Bacteria 4925
104 Ga0495602_0439183 3300048088 Bacteria 923
105 Ga0496115_0870368 3300048918 Unclassified 697
106 Ga0496122_0125165 3300048925 Bacteria 1647
107 Ga0496125_0000063 3300048928 Bacteria 250260
108 Ga0496126_0062287 3300048929 Bacteria 3348
109 Ga0501031_0331620 3300049568 Bacteria 985
110 Ga0501031_0796865 3300049568 Bacteria 606
111 Ga0501032_0452894 3300049569 Bacteria 822
112 Ga0501034_0100741 3300049571 Bacteria 2883
113 Ga0501034_0258512 3300049571 Bacteria 1685
114 Ga0501036_1102164 3300049572 Bacteria 648
115 Ga0501038_0066498 3300049574 Bacteria 3069
116 Ga0501047_0180188 3300049581 Bacteria 1979
117 Ga0501047_0424325 3300049581 Bacteria 1161
118 Ga0501047_0599694 3300049581 Bacteria 923
119 Ga0501047_0664539 3300049581 Unclassified 861
120 Ga0501070_0078788 3300049586 Bacteria 2726
121 Ga0501073_0017246 3300049589 Bacteria 5231
122 Ga0501074_0442698 3300049590 Bacteria 921
123 Ga0501080_0039700 3300049742 Bacteria 4393
124 Ga0501080_0169291 3300049742 Bacteria 2015
125 Ga0501080_0486108 3300049742 Bacteria 1104
126 Ga0501035_0308740 3300049822 Bacteria 1331
127 Ga0501044_0211168 3300049823 Bacteria 1895
128 Ga0501044_0237582 3300049823 Bacteria 1767
129 nmdc:mga0yw44_237902_c1 3300050492 Bacteria 1210
130 nmdc:mga06z11_23646_c1 3300050494 Bacteria 2890
131 nmdc:mga05p37_1424280_c1 3300050507 Unclassified 696
132 nmdc:mga06r32_719_c1 3300050510 Bacteria 29006
133 Ga0500651_0038617 3300053093 Bacteria 3007
134 Ga0500650_0279393 3300053098 Bacteria 743
135 Ga0500594_0017152 3300053118 Bacteria 1768
136 Ga0500658_0047115 3300053134 Bacteria 1748
137 Ga0500568_0078658 3300053139 Bacteria 1254
138 Ga0500588_0003451 3300053146 Bacteria 3337
139 Ga0500616_0249342 3300053153 Bacteria 759
140 Ga0500636_0109351 3300053177 Bacteria 1564
141 Ga0500609_018892 3300053731 Unclassified 939
142 2510893234 2510461076 Bacteria 8618824
143 2511183012 2510917028 Bacteria 6185411
144 2513871999 2513237138 Bacteria 7368160
145 2513910171 2513237144 Bacteria 7530820
146 2513930322 2513237146 Bacteria 7166346
147 2515637279 2515154113 Bacteria 7807172
148 2523106184 2522572158 Bacteria 6514390
149 2524610045 2524023250 Bacteria 5457705
150 2599414422 2599185170 Bacteria 7295545
151 2838042197 2838035591 Bacteria 7166484
152 2842338185 2842333319 Bacteria 8899485
153 2856324687 2856320880 Bacteria 7263508
154 2869281317 2869278585 Bacteria 7077053
155 2874141017 2874139085 Bacteria 7021506
156 2878742797 2878738818 Bacteria 7136951
157 2898799041 2898795034 Bacteria 4294459
158 2924780597 2924776078 Bacteria 7492003
159 2928526564 2928521798 Bacteria 4960112
160 2933017790 2933016740 Bacteria 6355406
161 2937974503 2937972304 Bacteria 7532020
162 2958037279 2958034702 Bacteria 6989922
163 2958046991 2958041894 Bacteria 13082850
164 2958099894 2958092219 Bacteria 6861151
165 2958151217 2958144490 Bacteria 6677056
166 2968019901 2968016561 Bacteria 7022047
167 2970473222 2970469710 Bacteria 6969209
168 2970595921 2970593180 Bacteria 7073582
169 2996351675 2996348954 Bacteria 7239054
170 3004278375 3004275668 Bacteria 7114440
171 8055622394 8055617313 Bacteria 7548464
172 Ga0075431_100015573
173 JGI25151J46595_10067585
174 Ga0055524_1040308
175 Ga0055531_10030663
176 Ga0070683_100221752
177 Ga0070661_100282069
178 Ga0070700_100959985
179 Ga0070706_100716381
180 Ga0070679_100582319
181 Ga0070679_100843960
182 Ga0070684_100032227
183 Ga0070684_100547902
184 Ga0068853_100268893
185 Ga0070665_100017051
186 Ga0068854_100093679
187 Ga0068856_100000020
188 Ga0068856_100116128
189 Ga0075367_10006670
190 Ga0075428_100749461
191 Ga0068865_100244486
192 Ga0099795_10013609
193 Ga0099795_10027279
194 Ga0099795_10048628
195 Ga0105240_10149774
196 Ga0105240_10490060
197 Ga0114129_11468789
198 Ga0105241_10146319
199 Ga0105241_11010930
200 Ga0105242_11899953
201 Ga0105237_10027711
202 Ga0105237_10099790
203 Ga0105237_10625095
204 Ga0105238_10008677
205 Ga0105238_10017327
206 Ga0105238_10420699
207 Ga0105238_11545563
208 Ga0099796_10070761
209 Ga0105239_10012339
210 Ga0105239_10016757
211 Ga0157369_10059399
212 Ga0157372_10753507
213 Ga0157379_12069583
214 Ga0157376_10561485
215 Ga0209148_1007640
216 Ga0209129_1046020
217 Ga0209025_1001729
218 Ga0209758_1013131
219 Ga0209257_1012683
220 Ga0207684_10875313
221 Ga0207671_10405451
222 Ga0207652_10500736
223 Ga0207694_10033195
224 Ga0207694_10378032
225 Ga0207711_10842225
226 Ga0207661_10146578
227 Ga0207640_10027537
228 Ga0207703_10564983
229 Ga0207702_10002142
230 Ga0207702_10746520
231 Ga0209179_1013790
232 Ga0209179_1050976
233 Ga0268266_10132834
234 Ga0307513_10488673
235 Ga0265314_10099962
236 Ga0373932_0102954
237 Ga0373937_0913014
238 Ga0395900_0008833
239 Ga0395900_0227624
240 Ga0395900_0307896
241 Ga0395898_0752086
242 Ga0395898_1427734
243 Ga0395905_0007436
244 Ga0436364_1289747
245 Ga0395901_0014654
246 Ga0395901_0024628
247 Ga0436365_0806583
248 Ga0451833_0162805
249 Ga0451835_0575654
250 Ga0451839_0497902
251 Ga0451845_0136441
252 Ga0451846_57984
253 Ga0451847_0498903
254 Ga0451849_0859084
255 Ga0451843_1614029
256 Ga0451843_1666585
257 Ga0451855_1128571
258 Ga0451853_2116920
259 Ga0453684_0588249
260 Ga0466960_0063576
261 Ga0495592_0259809
262 Ga0495638_0000683
263 Ga0495585_0037717
264 Ga0495606_0268915
265 Ga0495631_0023596
266 Ga0495648_0019481
267 Ga0495654_0164997
268 Ga0495622_0007146
269 Ga0495668_0057413
270 Ga0495661_0271931
271 Ga0495671_0053075
272 Ga0495600_0008814
273 Ga0495604_0070739
274 Ga0495672_0016736
275 Ga0495602_0439183
276 Ga0496115_0870368
277 Ga0496122_0125165
278 Ga0496125_0000063
279 Ga0496126_0062287
280 Ga0501031_0331620
281 Ga0501031_0796865
282 Ga0501032_0452894
283 Ga0501034_0100741
284 Ga0501034_0258512
285 Ga0501036_1102164
286 Ga0501038_0066498
287 Ga0501047_0180188
288 Ga0501047_0424325
289 Ga0501047_0599694
290 Ga0501047_0664539
291 Ga0501070_0078788
292 Ga0501073_0017246
293 Ga0501074_0442698
294 Ga0501080_0039700
295 Ga0501080_0169291
296 Ga0501080_0486108
297 Ga0501035_0308740
298 Ga0501044_0211168
299 Ga0501044_0237582
300 nmdc:mga0yw44_237902_c1
301 nmdc:mga06z11_23646_c1
302 nmdc:mga05p37_1424280_c1
303 nmdc:mga06r32_719_c1
304 Ga0500651_0038617
305 Ga0500650_0279393
306 Ga0500594_0017152
307 Ga0500658_0047115
308 Ga0500568_0078658
309 Ga0500588_0003451
310 Ga0500616_0249342
311 Ga0500636_0109351
312 Ga0500609_018892
313 2510893234
314 2511183012
315 2513871999
316 2513910171
317 2513930322
318 2515637279
319 2523106184
320 2524610045
321 2599414422
322 2838042197
323 2842338185
324 2856324687
325 2869281317
326 2874141017
327 2878742797
328 2898799041
329 2924780597
330 2928526564
331 2933017790
332 2937974503
333 2958037279
334 2958046991
335 2958099894
336 2958151217
337 2968019901
338 2970473222
339 2970595921
340 2996351675
341 3004278375
342 8055622394

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

25

159

0.93

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

16

150

0.73

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

46

152

0.62

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ak9-assembly1.cif.gz_A structure of salmonella tact3 toxin bound to taca3 antitoxin c-terminal peptide 0.9396 9 169
7ak9-assembly1.cif.gz_B structure of salmonella tact3 toxin bound to taca3 antitoxin c-terminal peptide 0.9378 9 169
7f36-assembly1.cif.gz_D tact complexed with acetyl-glycyl-trnagly 0.9283 10 161
5xun-assembly1.cif.gz_A crystal structure of y145f mutant of kact 0.9282 9 169
6g96-assembly1.cif.gz_B crystal structure of tact3 (trna acetylating toxin) from salmonella 0.92 9 169
ID Description Score Start End Superfamily
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9442 10 163 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9387 10 161 3.40.630.30
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.904 10 163 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8986 10 161 3.40.630.30
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8654 47 134 3.40.630.30
ID Description Score Start End GO Terms
AF-B4RLN7-F1-model_v4 Yeb 0.991 93 163 GO:0016747
AF-A0A1B8Q8E2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9903 9 162 GO:0016747
AF-A0A2K8U5A2-F1-model_v4 GNAT family N-acetyltransferase 0.9873 70 165 GO:0016747
AF-A0A442IDC4-F1-model_v4 GNAT family N-acetyltransferase 0.9856 9 170 GO:0016747
AF-A0A4V2QD44-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9834 10 170 GO:0016747

Map