F258183

General Info

Members Datasets Scaffolds Average Seq Length
171 102 342 142

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10056173|Ga0070709_100561732
Length 165
Sequence MVQFEPASEGCWCPLPLSLEERMKASMFYRIAAVLLVLFDAGHTSGYPWSDPKWGVDIGSMRSAHFYIMGFSRTYWDFYVGFGLFISVFLLLAVVLAWQLGRLPPESLALMRGTAWAFALCFAAITVLSWKYFFIIPIVFSIVTTLCLTAAAWLSPKQPFMPRSQ

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
18 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
37 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
38 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
69 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
72 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
90 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
93 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 92.4
Stem 0
Stem Tuber 0
Unclassified 28.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10056173 3300005434 Bacteria 2488
2 LJNas_1000481 3300000546 Bacteria 6994
3 Ga0070676_10118488 3300005328 Unclassified 1658
4 Ga0068869_100024044 3300005334 Bacteria 4217
5 Ga0070682_100054503 3300005337 Bacteria 2509
6 Ga0070714_100212242 3300005435 Bacteria 1775
7 Ga0070714_100436678 3300005435 Bacteria 1242
8 Ga0070714_100765865 3300005435 Bacteria 934
9 Ga0070713_100132969 3300005436 Unclassified 2196
10 Ga0070713_100253420 3300005436 Bacteria 1606
11 Ga0070713_100873700 3300005436 Bacteria 864
12 Ga0070713_101275901 3300005436 Bacteria 711
13 Ga0070710_10023570 3300005437 Bacteria 3237
14 Ga0070710_10092433 3300005437 Unclassified 1787
15 Ga0070710_10317258 3300005437 Bacteria 1022
16 Ga0070711_100014306 3300005439 Bacteria 4997
17 Ga0070711_100016978 3300005439 Unclassified 4627
18 Ga0070711_100039838 3300005439 Bacteria 3166
19 Ga0070681_10014637 3300005458 Bacteria 7803
20 Ga0070679_100001028 3300005530 Bacteria 24322
21 Ga0068853_101036915 3300005539 Unclassified 790
22 Ga0068856_100108269 3300005614 Bacteria 2775
23 Ga0068856_100271419 3300005614 Unclassified 1712
24 Ga0068856_101302941 3300005614 Bacteria 742
25 Ga0070717_10010351 3300006028 Bacteria 7037
26 Ga0070716_100000051 3300006173 Bacteria 45138
27 Ga0070716_100030002 3300006173 Bacteria 2946
28 Ga0070716_100049493 3300006173 Bacteria 2381
29 Ga0070716_101687942 3300006173 Unclassified 522
30 Ga0070712_100009093 3300006175 Bacteria 6257
31 Ga0070712_100016023 3300006175 Unclassified 4835
32 Ga0070712_100030962 3300006175 Bacteria 3601
33 Ga0070712_100127014 3300006175 Bacteria 1928
34 Ga0070712_100775226 3300006175 Bacteria 822
35 Ga0075433_10009501 3300006852 Bacteria 7771
36 Ga0075434_100004980 3300006871 Bacteria 12050
37 Ga0075434_102084567 3300006871 Unclassified 572
38 Ga0075436_100000026 3300006914 Bacteria 102984
39 Ga0075436_100010762 3300006914 Bacteria 6275
40 Ga0075436_100109539 3300006914 Bacteria 1927
41 Ga0075435_100016601 3300007076 Bacteria 5553
42 Ga0105240_10407041 3300009093 Bacteria 1531
43 Ga0114129_10009809 3300009147 Bacteria 13656
44 Ga0105241_10089137 3300009174 Bacteria 2430
45 Ga0105241_10117721 3300009174 Bacteria 2135
46 Ga0105241_10323401 3300009174 Bacteria 1331
47 Ga0105241_10555680 3300009174 Bacteria 1031
48 Ga0105241_10560009 3300009174 Bacteria 1027
49 Ga0105237_10270937 3300009545 Bacteria 1701
50 Ga0105237_10535810 3300009545 Unclassified 1177
51 Ga0105249_10916803 3300009553 Unclassified 943
52 Ga0157339_1032317 3300012505 Unclassified 618
53 Ga0157373_10009568 3300013100 Bacteria 7155
54 Ga0157371_10450393 3300013102 Bacteria 946
55 Ga0157370_10016167 3300013104 Bacteria 7564
56 Ga0157370_10090381 3300013104 Bacteria 2875
57 Ga0157369_10006889 3300013105 Bacteria 13114
58 Ga0157369_10147171 3300013105 Bacteria 2490
59 Ga0163162_10023719 3300013306 Bacteria 6055
60 Ga0157372_10003061 3300013307 Bacteria 18018
61 Ga0157372_10226856 3300013307 Bacteria 2166
62 Ga0182008_10573968 3300014497 Unclassified 630
63 Ga0157379_10120793 3300014968 Bacteria 2356
64 Ga0157376_10992284 3300014969 Bacteria 862
65 Ga0157376_12460942 3300014969 Unclassified 560
66 Ga0163161_11054406 3300017792 Unclassified 696
67 Ga0213873_10297030 3300021358 Unclassified 521
68 Ga0213874_10197593 3300021377 Unclassified 722
69 Ga0213874_10325295 3300021377 Unclassified 584
70 Ga0213876_10041680 3300021384 Bacteria 2426
71 Ga0213875_10191969 3300021388 Unclassified 960
72 Ga0228598_1006935 3300024227 Bacteria 2326
73 Ga0207692_10003588 3300025898 Bacteria 6073
74 Ga0207692_10098306 3300025898 Unclassified 1601
75 Ga0207699_10058201 3300025906 Bacteria 2311
76 Ga0207699_10241519 3300025906 Bacteria 1241
77 Ga0207645_10075389 3300025907 Bacteria 2159
78 Ga0207654_10688877 3300025911 Bacteria 734
79 Ga0207654_11017291 3300025911 Bacteria 603
80 Ga0207707_10006030 3300025912 Bacteria 10603
81 Ga0207695_10005677 3300025913 Bacteria 16462
82 Ga0207695_10022784 3300025913 Bacteria 7096
83 Ga0207695_10268151 3300025913 Bacteria 1603
84 Ga0207671_10101267 3300025914 Bacteria 2182
85 Ga0207693_10022767 3300025915 Unclassified 4975
86 Ga0207693_10040268 3300025915 Bacteria 3680
87 Ga0207693_10090632 3300025915 Bacteria 2397
88 Ga0207693_10100259 3300025915 Bacteria 2270
89 Ga0207693_10891630 3300025915 Unclassified 683
90 Ga0207663_10037604 3300025916 Bacteria 2919
91 Ga0207663_10166433 3300025916 Unclassified 1562
92 Ga0207663_10724270 3300025916 Bacteria 789
93 Ga0207660_10048241 3300025917 Bacteria 3013
94 Ga0207652_10025259 3300025921 Bacteria 4937
95 Ga0207646_11191092 3300025922 Bacteria 668
96 Ga0207700_10113106 3300025928 Unclassified 2188
97 Ga0207700_10308859 3300025928 Bacteria 1367
98 Ga0207700_10423561 3300025928 Bacteria 1170
99 Ga0207700_10787192 3300025928 Bacteria 850
100 Ga0207700_11024232 3300025928 Unclassified 739
101 Ga0207664_10064987 3300025929 Bacteria 2920
102 Ga0207686_10000452 3300025934 Bacteria 27262
103 Ga0207665_10000094 3300025939 Bacteria 57524
104 Ga0207665_10010114 3300025939 Bacteria 6195
105 Ga0207665_10082010 3300025939 Bacteria 2222
106 Ga0207689_10391398 3300025942 Unclassified 1158
107 Ga0207651_10673576 3300025960 Unclassified 910
108 Ga0207640_10152817 3300025981 Bacteria 1698
109 Ga0207702_10444574 3300026078 Bacteria 1257
110 Ga0207702_11276378 3300026078 Bacteria 728
111 Ga0207675_100244395 3300026118 Unclassified 1735
112 Ga0209588_1145097 3300027671 Unclassified 753
113 Ga0265770_1010365 3300030878 Unclassified 1351
114 Ga0265765_1054371 3300030879 Unclassified 555
115 Ga0265773_1049012 3300031018 Bacteria 502
116 Ga0373926_0147593 3300035083 Bacteria 895
117 Ga0373932_0000644 3300035112 Bacteria 10613
118 Ga0373932_0168822 3300035112 Unclassified 761
119 Ga0373931_0374499 3300035691 Unclassified 896
120 Ga0373935_0147501 3300035692 Bacteria 1594
121 Ga0373927_0019420 3300035695 Bacteria 4457
122 Ga0373927_0042621 3300035695 Unclassified 2941
123 Ga0373933_0259692 3300035724 Bacteria 1120
124 Ga0373947_0926532 3300035725 Bacteria 595
125 Ga0373925_0074196 3300037068 Bacteria 2576
126 Ga0373925_0420648 3300037068 Bacteria 1092
127 Ga0436364_0492750 3300037853 Bacteria 3094
128 Ga0436364_0832380 3300037853 Unclassified 1458
129 Ga0242420_089064 3300038996 Unclassified 646
130 Ga0436365_1281675 3300039437 Unclassified 615
131 Ga0436365_1532279 3300039437 Bacteria 4773
132 Ga0436360_0620824 3300039438 Bacteria 1490
133 Ga0436360_0858139 3300039438 Unclassified 798
134 Ga0436361_0585361 3300039447 Unclassified 595
135 Ga0436361_1195081 3300039447 Bacteria 912
136 Ga0436363_0149473 3300039450 Bacteria 937
137 Ga0436363_0714140 3300039450 Unclassified 563
138 Ga0436362_0039761 3300039453 Unclassified 1273
139 Ga0436362_0963026 3300039453 Bacteria 4074
140 Ga0436362_1162506 3300039453 Bacteria 3450
141 Ga0436362_1233466 3300039453 Unclassified 506
142 Ga0451576_0593781 3300045051 Viruses 1164
143 Ga0495580_0000542 3300046472 Bacteria 31897
144 Ga0495580_0000811 3300046472 Bacteria 27066
145 Ga0495580_0042675 3300046472 Bacteria 3230
146 Ga0495582_0028663 3300046473 Bacteria 3056
147 Ga0495582_0185385 3300046473 Unclassified 1186
148 Ga0495630_0086250 3300046517 Bacteria 2371
149 Ga0495630_0306216 3300046517 Bacteria 1214
150 Ga0495630_1524709 3300046517 Unclassified 501
151 Ga0495635_1014840 3300046663 Unclassified 528
152 Ga0495623_0126076 3300046679 Bacteria 1537
153 Ga0495658_0070646 3300046683 Bacteria 2026
154 Ga0495581_0620926 3300047315 Unclassified 625
155 Ga0495674_0606322 3300047319 Unclassified 867
156 Ga0495675_0034804 3300047444 Bacteria 3216
157 Ga0495684_0031372 3300047471 Bacteria 4080
158 Ga0495602_0502540 3300048088 Bacteria 847
159 Ga0496102_0161007 3300048905 Bacteria 2111
160 Ga0496104_0907061 3300048907 Bacteria 786
161 Ga0496106_0083814 3300048909 Bacteria 2452
162 Ga0501069_0224851 3300049585 Bacteria 1092
163 nmdc:mga05p37_68194_c1 3300050507 Unclassified 4375
164 nmdc:mga0n895_50118_c1 3300050512 Bacteria 4093
165 nmdc:mga0n895_919965_c1 3300050512 Bacteria 859
166 nmdc:mga0rr50_11820_c1 3300050513 Bacteria 5607
167 nmdc:mga0rr50_170976_c1 3300050513 Bacteria 1771
168 nmdc:mga0rr50_9910_c1 3300050513 Bacteria 6023
169 nmdc:mga08x19_26_c1 3300050514 Bacteria 228913
170 nmdc:mga08x19_65773_c1 3300050514 Bacteria 2355
171 nmdc:mga0a205_55842_c1 3300050515 Bacteria 3813
172 Ga0070709_10056173
173 LJNas_1000481
174 Ga0070676_10118488
175 Ga0068869_100024044
176 Ga0070682_100054503
177 Ga0070714_100212242
178 Ga0070714_100436678
179 Ga0070714_100765865
180 Ga0070713_100132969
181 Ga0070713_100253420
182 Ga0070713_100873700
183 Ga0070713_101275901
184 Ga0070710_10023570
185 Ga0070710_10092433
186 Ga0070710_10317258
187 Ga0070711_100014306
188 Ga0070711_100016978
189 Ga0070711_100039838
190 Ga0070681_10014637
191 Ga0070679_100001028
192 Ga0068853_101036915
193 Ga0068856_100108269
194 Ga0068856_100271419
195 Ga0068856_101302941
196 Ga0070717_10010351
197 Ga0070716_100000051
198 Ga0070716_100030002
199 Ga0070716_100049493
200 Ga0070716_101687942
201 Ga0070712_100009093
202 Ga0070712_100016023
203 Ga0070712_100030962
204 Ga0070712_100127014
205 Ga0070712_100775226
206 Ga0075433_10009501
207 Ga0075434_100004980
208 Ga0075434_102084567
209 Ga0075436_100000026
210 Ga0075436_100010762
211 Ga0075436_100109539
212 Ga0075435_100016601
213 Ga0105240_10407041
214 Ga0114129_10009809
215 Ga0105241_10089137
216 Ga0105241_10117721
217 Ga0105241_10323401
218 Ga0105241_10555680
219 Ga0105241_10560009
220 Ga0105237_10270937
221 Ga0105237_10535810
222 Ga0105249_10916803
223 Ga0157339_1032317
224 Ga0157373_10009568
225 Ga0157371_10450393
226 Ga0157370_10016167
227 Ga0157370_10090381
228 Ga0157369_10006889
229 Ga0157369_10147171
230 Ga0163162_10023719
231 Ga0157372_10003061
232 Ga0157372_10226856
233 Ga0182008_10573968
234 Ga0157379_10120793
235 Ga0157376_10992284
236 Ga0157376_12460942
237 Ga0163161_11054406
238 Ga0213873_10297030
239 Ga0213874_10197593
240 Ga0213874_10325295
241 Ga0213876_10041680
242 Ga0213875_10191969
243 Ga0228598_1006935
244 Ga0207692_10003588
245 Ga0207692_10098306
246 Ga0207699_10058201
247 Ga0207699_10241519
248 Ga0207645_10075389
249 Ga0207654_10688877
250 Ga0207654_11017291
251 Ga0207707_10006030
252 Ga0207695_10005677
253 Ga0207695_10022784
254 Ga0207695_10268151
255 Ga0207671_10101267
256 Ga0207693_10022767
257 Ga0207693_10040268
258 Ga0207693_10090632
259 Ga0207693_10100259
260 Ga0207693_10891630
261 Ga0207663_10037604
262 Ga0207663_10166433
263 Ga0207663_10724270
264 Ga0207660_10048241
265 Ga0207652_10025259
266 Ga0207646_11191092
267 Ga0207700_10113106
268 Ga0207700_10308859
269 Ga0207700_10423561
270 Ga0207700_10787192
271 Ga0207700_11024232
272 Ga0207664_10064987
273 Ga0207686_10000452
274 Ga0207665_10000094
275 Ga0207665_10010114
276 Ga0207665_10082010
277 Ga0207689_10391398
278 Ga0207651_10673576
279 Ga0207640_10152817
280 Ga0207702_10444574
281 Ga0207702_11276378
282 Ga0207675_100244395
283 Ga0209588_1145097
284 Ga0265770_1010365
285 Ga0265765_1054371
286 Ga0265773_1049012
287 Ga0373926_0147593
288 Ga0373932_0000644
289 Ga0373932_0168822
290 Ga0373931_0374499
291 Ga0373935_0147501
292 Ga0373927_0019420
293 Ga0373927_0042621
294 Ga0373933_0259692
295 Ga0373947_0926532
296 Ga0373925_0074196
297 Ga0373925_0420648
298 Ga0436364_0492750
299 Ga0436364_0832380
300 Ga0242420_089064
301 Ga0436365_1281675
302 Ga0436365_1532279
303 Ga0436360_0620824
304 Ga0436360_0858139
305 Ga0436361_0585361
306 Ga0436361_1195081
307 Ga0436363_0149473
308 Ga0436363_0714140
309 Ga0436362_0039761
310 Ga0436362_0963026
311 Ga0436362_1162506
312 Ga0436362_1233466
313 Ga0451576_0593781
314 Ga0495580_0000542
315 Ga0495580_0000811
316 Ga0495580_0042675
317 Ga0495582_0028663
318 Ga0495582_0185385
319 Ga0495630_0086250
320 Ga0495630_0306216
321 Ga0495630_1524709
322 Ga0495635_1014840
323 Ga0495623_0126076
324 Ga0495658_0070646
325 Ga0495581_0620926
326 Ga0495674_0606322
327 Ga0495675_0034804
328 Ga0495684_0031372
329 Ga0495602_0502540
330 Ga0496102_0161007
331 Ga0496104_0907061
332 Ga0496106_0083814
333 Ga0501069_0224851
334 nmdc:mga05p37_68194_c1
335 nmdc:mga0n895_50118_c1
336 nmdc:mga0n895_919965_c1
337 nmdc:mga0rr50_11820_c1
338 nmdc:mga0rr50_170976_c1
339 nmdc:mga0rr50_9910_c1
340 nmdc:mga08x19_26_c1
341 nmdc:mga08x19_65773_c1
342 nmdc:mga0a205_55842_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dgj-assembly1.cif.gz_A structural basis of microrna biogenesis by dicer-1 and its partner protein loqs-pb - complex ib 0.4347 1 141
3qd8-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis bfrb 0.4302 2 141
6wvh-assembly1.cif.gz_A human vkor with brodifacoum 0.4186 3 138
6wvh-assembly1.cif.gz_A human vkor with brodifacoum 0.4013 3 138
6n63-assembly1.cif.gz_A-2 crystal structure of an iron binding protein 0.3987 3 144
ID Description Score Start End Superfamily
af_A0A0B4K7V7_1_126_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6299 3 131 1.20.1070.10
af_Q2G1M3_1_135_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5953 3 144 1.20.140.150
af_A0A0B4K7V7_1_126_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.591 3 131 1.20.1070.10
af_Q9VTE5_9_118_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5744 4 75 1.10.287.370
af_A0A0R0G5K6_1_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5669 3 136 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2N9MT78-F1-model_v4 Uncharacterized protein 0.9798 1 134 GO:0016020
AF-A0A2V7Q5J9-F1-model_v4 Uncharacterized protein 0.9747 1 134 GO:0016020
AF-A0A2V5XME8-F1-model_v4 Uncharacterized protein 0.9674 42 134 GO:0016020
AF-A0A2V7Q5J9-F1-model_v4 Uncharacterized protein 0.9404 1 134 GO:0016020
AF-A0A1Q7ZVE3-F1-model_v4 Uncharacterized protein 0.9397 1 92 GO:0016020

Map