F257958

General Info

Members Datasets Scaffolds Average Seq Length
171 138 342 72

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10267815|Ga0065707_102678152
Length 84
Sequence MAYNLHFYLLFINSNMRTVGIILIVVGIAMLLFRGFSVKTEEKVIDVGPLEVNKKENKWIGWPVYAGGIAIVAGLIMVVADRKK

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
73 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
84 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
85 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
86 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
87 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
88 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
89 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
90 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
91 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
92 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
93 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
110 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
111 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
112 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
113 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
114 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
115 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
118 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
119 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
124 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
125 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
126 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
127 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
128 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
129 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
130 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
131 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
132 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
133 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
136 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
137 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
138 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.7
Nodule 0
Rhizoplane 2.34
Rhizosphere 79.53
Stem 0
Stem Tuber 0
Unclassified 15.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10267815 3300005295 Bacteria 1079
2 Ga0006778J45830_1121761 3300003162 Bacteria 693
3 rootH1_10003061 3300003316 Bacteria 11861
4 rootH2_10018356 3300003320 Bacteria 38384
5 rootL2_10014731 3300003322 Bacteria 30193
6 rootL2_10050746 3300003322 Bacteria 1827
7 rootL2_10288607 3300003322 Bacteria 2461
8 rootH1_10002485 3300003323 Bacteria 66401
9 rootH1_10039020 3300003323 Bacteria 13908
10 rootH1_10152459 3300003323 Bacteria 1591
11 Ga0070658_11790423 3300005327 Unclassified 531
12 Ga0070666_10000424 3300005335 Bacteria 26177
13 Ga0070682_101070891 3300005337 Bacteria 673
14 Ga0068868_100076430 3300005338 Bacteria 2677
15 Ga0070668_101265576 3300005347 Bacteria 670
16 Ga0070671_100241440 3300005355 Bacteria 1534
17 Ga0070673_100342387 3300005364 Bacteria 1325
18 Ga0070688_100609872 3300005365 Bacteria 836
19 Ga0070667_100021134 3300005367 Bacteria 5407
20 Ga0070667_100545531 3300005367 Unclassified 1065
21 Ga0068867_100098367 3300005459 Bacteria 2231
22 Ga0070685_10437410 3300005466 Bacteria 913
23 Ga0068853_101328434 3300005539 Bacteria 695
24 Ga0070672_101286154 3300005543 Bacteria 653
25 Ga0070704_101002971 3300005549 Bacteria 755
26 Ga0068852_100163009 3300005616 Unclassified 2083
27 Ga0068852_100942044 3300005616 Bacteria 881
28 Ga0068859_100000960 3300005617 Bacteria 29521
29 Ga0068864_100009103 3300005618 Bacteria 8185
30 Ga0068864_100800336 3300005618 Bacteria 926
31 Ga0068870_10838273 3300005840 Bacteria 645
32 Ga0068863_100013476 3300005841 Bacteria 7886
33 Ga0068858_100010191 3300005842 Bacteria 8921
34 Ga0068862_100897581 3300005844 Bacteria 871
35 Ga0070717_10824104 3300006028 Bacteria 844
36 Ga0097620_100000960 3300006931 Bacteria 29521
37 Ga0097620_100800241 3300006931 Bacteria 1030
38 Ga0111539_10026554 3300009094 Bacteria 7079
39 Ga0105247_10005369 3300009101 Bacteria 8077
40 Ga0105243_10287829 3300009148 Unclassified 1483
41 Ga0105241_10001471 3300009174 Bacteria 18063
42 Ga0105237_10024905 3300009545 Bacteria 6122
43 Ga0105249_10010593 3300009553 Bacteria 8099
44 Ga0105249_10436066 3300009553 Bacteria 1347
45 Ga0105249_11266401 3300009553 Bacteria 809
46 Ga0105239_10236720 3300010375 Bacteria 2049
47 Ga0105246_10033931 3300011119 Bacteria 3395
48 Ga0105246_10089338 3300011119 Bacteria 2216
49 Ga0157371_10520801 3300013102 Bacteria 879
50 Ga0157370_10168989 3300013104 Bacteria 2033
51 Ga0157370_11491619 3300013104 Bacteria 608
52 Ga0157378_10067643 3300013297 Bacteria 3202
53 Ga0157378_12458772 3300013297 Bacteria 573
54 Ga0163162_10000414 3300013306 Bacteria 39202
55 Ga0157372_11304466 3300013307 Bacteria 838
56 Ga0157375_10116240 3300013308 Bacteria 2779
57 Ga0157375_10639334 3300013308 Bacteria 1221
58 Ga0163163_10167411 3300014325 Bacteria 2244
59 Ga0157380_10027864 3300014326 Bacteria 4302
60 Ga0157380_10566056 3300014326 Bacteria 1118
61 Ga0157379_10199586 3300014968 Unclassified 1809
62 Ga0157376_10132233 3300014969 Bacteria 2228
63 Ga0157376_11446912 3300014969 Bacteria 719
64 Ga0209050_1074647 3300025298 Unclassified 744
65 Ga0209257_1035452 3300025304 Bacteria 1544
66 Ga0207710_10040263 3300025900 Unclassified 2070
67 Ga0207680_10000036 3300025903 Bacteria 73025
68 Ga0207654_10001486 3300025911 Bacteria 12386
69 Ga0207671_10179606 3300025914 Unclassified 1647
70 Ga0207681_11099287 3300025923 Bacteria 668
71 Ga0207644_10732658 3300025931 Bacteria 825
72 Ga0207711_11422932 3300025941 Bacteria 636
73 Ga0207689_10000360 3300025942 Bacteria 42854
74 Ga0207651_10052320 3300025960 Bacteria 2784
75 Ga0207712_10331108 3300025961 Bacteria 1260
76 Ga0207712_10475211 3300025961 Bacteria 1064
77 Ga0207712_11865187 3300025961 Bacteria 538
78 Ga0207658_10018281 3300025986 Bacteria 4838
79 Ga0207677_10074120 3300026023 Bacteria 2414
80 Ga0207703_10011813 3300026035 Bacteria 6799
81 Ga0207639_10491350 3300026041 Bacteria 1120
82 Ga0207641_10005104 3300026088 Bacteria 11248
83 Ga0207648_10450434 3300026089 Bacteria 1172
84 Ga0207648_10958357 3300026089 Bacteria 800
85 Ga0207676_10003780 3300026095 Bacteria 10698
86 Ga0207676_11186707 3300026095 Bacteria 756
87 Ga0207675_100636713 3300026118 Bacteria 1072
88 Ga0207698_10134530 3300026142 Unclassified 2119
89 Ga0207698_10265268 3300026142 Bacteria 1580
90 Ga0207428_10088180 3300027907 Bacteria 2413
91 Ga0268265_12647992 3300028380 Bacteria 507
92 Ga0268264_10001262 3300028381 Bacteria 24026
93 Ga0316177_1173040 3300030731 Bacteria 868
94 Ga0307513_10390187 3300031456 Bacteria 1129
95 Ga0307509_10090609 3300031507 Unclassified 3133
96 Ga0307408_100039782 3300031548 Bacteria 3326
97 Ga0307413_11919223 3300031824 Bacteria 532
98 Ga0307406_10059623 3300031901 Bacteria 2458
99 Ga0307414_10026803 3300032004 Bacteria 3714
100 Ga0307414_10999347 3300032004 Bacteria 770
101 Ga0307411_11419952 3300032005 Bacteria 636
102 Ga0307415_102242401 3300032126 Bacteria 535
103 Ga0395899_0158963 3300037312 Bacteria 1598
104 Ga0395901_0016621 3300038443 Bacteria 7497
105 Ga0439447_065641 3300041407 Bacteria 849
106 Ga0451791_0968504 3300041451 Bacteria 710
107 Ga0451795_1322993 3300041456 Unclassified 508
108 Ga0451807_1297969 3300041486 Bacteria 550
109 Ga0451807_1457053 3300041486 Unclassified 510
110 Ga0451853_0620789 3300041512 Unclassified 618
111 Ga0439431_0049632 3300041997 Bacteria 1086
112 Ga0439431_0102997 3300041997 Bacteria 786
113 Ga0439442_048066 3300042002 Bacteria 899
114 Ga0439449_0208938 3300042007 Bacteria 731
115 Ga0439457_062394 3300042014 Bacteria 845
116 Ga0450894_026638 3300042131 Bacteria 795
117 Ga0450899_006418 3300042135 Bacteria 1274
118 Ga0439434_0013029 3300042435 Bacteria 2466
119 Ga0466965_0209264 3300044683 Bacteria 1037
120 Ga0495632_0471630 3300046519 Bacteria 543
121 Ga0495643_0130642 3300046522 Unclassified 1261
122 Ga0495597_0345115 3300046542 Bacteria 572
123 Ga0495625_0127184 3300046660 Unclassified 1729
124 Ga0495686_0016014 3300047472 Bacteria 5097
125 Ga0495686_0040374 3300047472 Bacteria 2976
126 Ga0501300_001636 3300049523 Bacteria 3353
127 Ga0501034_0032051 3300049571 Bacteria 5339
128 Ga0501034_0618984 3300049571 Unclassified 987
129 Ga0501034_1596677 3300049571 Unclassified 525
130 Ga0501036_0666453 3300049572 Bacteria 861
131 Ga0501037_0010051 3300049573 Bacteria 6942
132 Ga0501039_0460986 3300049575 Unclassified 998
133 Ga0501043_0021306 3300049579 Bacteria 5081
134 Ga0501043_0062675 3300049579 Bacteria 2920
135 Ga0501047_0062425 3300049581 Bacteria 3594
136 Ga0501047_0693762 3300049581 Bacteria 836
137 Ga0501047_0908431 3300049581 Unclassified 694
138 Ga0501048_0158975 3300049582 Bacteria 1599
139 Ga0501202_002985 3300049652 Bacteria 2873
140 Ga0501210_015878 3300049657 Unclassified 664
141 Ga0501217_002986 3300049661 Bacteria 3387
142 Ga0501236_000147 3300049670 Bacteria 7220
143 Ga0501247_002266 3300049677 Unclassified 1986
144 Ga0501257_033142 3300049686 Bacteria 1250
145 Ga0501261_095016 3300049690 Unclassified 559
146 Ga0501080_1316606 3300049742 Unclassified 618
147 Ga0501264_000007 3300049761 Bacteria 29622
148 Ga0501271_010854 3300049768 Bacteria 968
149 Ga0501035_0115187 3300049822 Bacteria 2353
150 Ga0501044_0018114 3300049823 Bacteria 7552
151 nmdc:mga0k408_260290_c1 3300050493 Bacteria 1036
152 nmdc:mga0k408_66927_c1 3300050493 Bacteria 2093
153 nmdc:mga08y16_12569_c1 3300050511 Bacteria 8907
154 nmdc:mga08y16_1269666_c1 3300050511 Bacteria 704
155 Ga0500578_0553468 3300053086 Unclassified 639
156 Ga0500644_0035621 3300053088 Bacteria 1614
157 Ga0500650_0478938 3300053098 Unclassified 531
158 Ga0500660_126468 3300053100 Bacteria 1051
159 Ga0500569_044715 3300053109 Bacteria 1312
160 Ga0500607_046087 3300053121 Bacteria 2338
161 Ga0500652_106383 3300053131 Bacteria 1173
162 Ga0500655_009793 3300053133 Unclassified 1730
163 Ga0500658_0128985 3300053134 Bacteria 1126
164 Ga0500561_0169322 3300053137 Unclassified 685
165 Ga0500577_0006065 3300053142 Bacteria 3303
166 Ga0500616_0000024 3300053153 Bacteria 455811
167 Ga0500616_0025323 3300053153 Bacteria 3292
168 Ga0500622_0093339 3300053156 Bacteria 1490
169 Ga0500633_0045585 3300053160 Bacteria 1494
170 Ga0500645_170843 3300053730 Bacteria 594
171 Ga0587076_075338 3300059645 Bacteria 709
172 Ga0065707_10267815
173 Ga0006778J45830_1121761
174 rootH1_10003061
175 rootH2_10018356
176 rootL2_10014731
177 rootL2_10050746
178 rootL2_10288607
179 rootH1_10002485
180 rootH1_10039020
181 rootH1_10152459
182 Ga0070658_11790423
183 Ga0070666_10000424
184 Ga0070682_101070891
185 Ga0068868_100076430
186 Ga0070668_101265576
187 Ga0070671_100241440
188 Ga0070673_100342387
189 Ga0070688_100609872
190 Ga0070667_100021134
191 Ga0070667_100545531
192 Ga0068867_100098367
193 Ga0070685_10437410
194 Ga0068853_101328434
195 Ga0070672_101286154
196 Ga0070704_101002971
197 Ga0068852_100163009
198 Ga0068852_100942044
199 Ga0068859_100000960
200 Ga0068864_100009103
201 Ga0068864_100800336
202 Ga0068870_10838273
203 Ga0068863_100013476
204 Ga0068858_100010191
205 Ga0068862_100897581
206 Ga0070717_10824104
207 Ga0097620_100000960
208 Ga0097620_100800241
209 Ga0111539_10026554
210 Ga0105247_10005369
211 Ga0105243_10287829
212 Ga0105241_10001471
213 Ga0105237_10024905
214 Ga0105249_10010593
215 Ga0105249_10436066
216 Ga0105249_11266401
217 Ga0105239_10236720
218 Ga0105246_10033931
219 Ga0105246_10089338
220 Ga0157371_10520801
221 Ga0157370_10168989
222 Ga0157370_11491619
223 Ga0157378_10067643
224 Ga0157378_12458772
225 Ga0163162_10000414
226 Ga0157372_11304466
227 Ga0157375_10116240
228 Ga0157375_10639334
229 Ga0163163_10167411
230 Ga0157380_10027864
231 Ga0157380_10566056
232 Ga0157379_10199586
233 Ga0157376_10132233
234 Ga0157376_11446912
235 Ga0209050_1074647
236 Ga0209257_1035452
237 Ga0207710_10040263
238 Ga0207680_10000036
239 Ga0207654_10001486
240 Ga0207671_10179606
241 Ga0207681_11099287
242 Ga0207644_10732658
243 Ga0207711_11422932
244 Ga0207689_10000360
245 Ga0207651_10052320
246 Ga0207712_10331108
247 Ga0207712_10475211
248 Ga0207712_11865187
249 Ga0207658_10018281
250 Ga0207677_10074120
251 Ga0207703_10011813
252 Ga0207639_10491350
253 Ga0207641_10005104
254 Ga0207648_10450434
255 Ga0207648_10958357
256 Ga0207676_10003780
257 Ga0207676_11186707
258 Ga0207675_100636713
259 Ga0207698_10134530
260 Ga0207698_10265268
261 Ga0207428_10088180
262 Ga0268265_12647992
263 Ga0268264_10001262
264 Ga0316177_1173040
265 Ga0307513_10390187
266 Ga0307509_10090609
267 Ga0307408_100039782
268 Ga0307413_11919223
269 Ga0307406_10059623
270 Ga0307414_10026803
271 Ga0307414_10999347
272 Ga0307411_11419952
273 Ga0307415_102242401
274 Ga0395899_0158963
275 Ga0395901_0016621
276 Ga0439447_065641
277 Ga0451791_0968504
278 Ga0451795_1322993
279 Ga0451807_1297969
280 Ga0451807_1457053
281 Ga0451853_0620789
282 Ga0439431_0049632
283 Ga0439431_0102997
284 Ga0439442_048066
285 Ga0439449_0208938
286 Ga0439457_062394
287 Ga0450894_026638
288 Ga0450899_006418
289 Ga0439434_0013029
290 Ga0466965_0209264
291 Ga0495632_0471630
292 Ga0495643_0130642
293 Ga0495597_0345115
294 Ga0495625_0127184
295 Ga0495686_0016014
296 Ga0495686_0040374
297 Ga0501300_001636
298 Ga0501034_0032051
299 Ga0501034_0618984
300 Ga0501034_1596677
301 Ga0501036_0666453
302 Ga0501037_0010051
303 Ga0501039_0460986
304 Ga0501043_0021306
305 Ga0501043_0062675
306 Ga0501047_0062425
307 Ga0501047_0693762
308 Ga0501047_0908431
309 Ga0501048_0158975
310 Ga0501202_002985
311 Ga0501210_015878
312 Ga0501217_002986
313 Ga0501236_000147
314 Ga0501247_002266
315 Ga0501257_033142
316 Ga0501261_095016
317 Ga0501080_1316606
318 Ga0501264_000007
319 Ga0501271_010854
320 Ga0501035_0115187
321 Ga0501044_0018114
322 nmdc:mga0k408_260290_c1
323 nmdc:mga0k408_66927_c1
324 nmdc:mga08y16_12569_c1
325 nmdc:mga08y16_1269666_c1
326 Ga0500578_0553468
327 Ga0500644_0035621
328 Ga0500650_0478938
329 Ga0500660_126468
330 Ga0500569_044715
331 Ga0500607_046087
332 Ga0500652_106383
333 Ga0500655_009793
334 Ga0500658_0128985
335 Ga0500561_0169322
336 Ga0500577_0006065
337 Ga0500616_0000024
338 Ga0500616_0025323
339 Ga0500622_0093339
340 Ga0500633_0045585
341 Ga0500645_170843
342 Ga0587076_075338

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vd7-assembly1.cif.gz_A cryo-em structure of xenopus tropicalis pannexin 1 channel 0.5454 5 65
7wsv-assembly1.cif.gz_A cryo-em structure of the n-terminal deletion mutant of human pannexin-1 in a nanodisc 0.5146 5 63
8dxp-assembly1.cif.gz_D structure of lrrc8c-lrrc8a(il125) chimera, class 3 0.4972 5 64
6vd7-assembly1.cif.gz_A cryo-em structure of xenopus tropicalis pannexin 1 channel 0.4967 5 65
1sfx-assembly1.cif.gz_A x-ray crystal structure of putative hth transcription regulator from archaeoglobus fulgidus 0.488 11 68
ID Description Score Start End Superfamily
af_A0A6M3QAV0_1_161_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6576 2 63 1.20.140.150
af_P23482_1_130_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.602 5 68 1.20.1070.10
af_P16429_1_123_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5911 5 65 1.20.1070.10
af_Q9VTT1_11_110_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5386 2 68 1.10.287.370
af_F1LV86_1_179_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5317 2 68 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1M5T2S7-F1-model_v4 LPXTG-motif cell wall anchor domain-containing protein 0.8955 2 67 GO:0016020
AF-A0A5C7RPT8-F1-model_v4 DUF3185 domain-containing protein 0.8941 2 65 GO:0016020
AF-A0A4R3MYZ7-F1-model_v4 Secreted protein with PEP-CTERM sorting signal 0.8845 2 64 GO:0016020
AF-D3RSD1-F1-model_v4 Uncharacterized protein 0.864 2 63 GO:0016020
AF-A0A1M5T2S7-F1-model_v4 LPXTG-motif cell wall anchor domain-containing protein 0.849 2 67 GO:0016020

Map