F257549

General Info

Members Datasets Scaffolds Average Seq Length
170 96 169 332

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0000933|Ga0501033_0000933_1941_3113
Length 390
Sequence VFAGLDMNSDNPRGNGGVFRMALQEIQPESVVDRYANFHPPGSIVLKKEKKMFKSRTLKVFVLTAALVPLAMASVPATNAEIRIDGSSTMYPITDNVAKDFQEAKKEKVGIKIGISGTGGGFAKFCRQEIDIVNASRPILGKEMRACSKAGVRYVELPVAFDALTVVVNPKNDWSRTMTVDELRKIWQPAATNKITKWSQVNPAWPDQKLKLYAAGPGSGTFDYFTTVIMGKPKASRSDFTASKEDDVNVVLQGVEGDKYALGFLGFGYYAQNKDKVAAVAIDNDTGEAIMPSVETVEDGTYQPLSRPIFIYVNMKAAERPVVKEFVEFYMKNASAMARGTHYFPLPPRAYRANLEFFKTKRLGTVFDGFVPEGLTIDDLLKREARFYEN

Samples

Sample ID Description Type Environment
1 2547132512 Azospira oryzae 6a3 Isolate Unclassified
2 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
3 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
25 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
26 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
33 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
36 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
40 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
45 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
48 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
49 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
50 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
55 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
56 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
57 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
58 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
59 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
60 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
61 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
62 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
63 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
64 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
65 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
66 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
67 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
79 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
80 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
81 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
82 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
83 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
84 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
85 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
86 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
87 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
90 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
91 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
92 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
93 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
94 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.29
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100305331 3300005339 Bacteria 1305
2 Ga0070669_100284298 3300005353 Bacteria 1326
3 Ga0070674_100282824 3300005356 Bacteria 1315
4 Ga0070659_100241929 3300005366 Bacteria 1494
5 Ga0070667_100400137 3300005367 Bacteria 1250
6 Ga0070714_100003989 3300005435 Bacteria 11096
7 Ga0070714_100028842 3300005435 Bacteria 4609
8 Ga0070662_100175730 3300005457 Unclassified 1685
9 Ga0070706_100299688 3300005467 Bacteria 1500
10 Ga0070699_100242508 3300005518 Unclassified 1609
11 Ga0070679_100044920 3300005530 Bacteria 4402
12 Ga0068853_100245127 3300005539 Bacteria 1643
13 Ga0068859_100616020 3300005617 Bacteria 1178
14 Ga0068862_100017080 3300005844 Bacteria 6038
15 Ga0081455_10112065 3300005937 Unclassified 2166
16 Ga0075428_100012151 3300006844 Bacteria 9578
17 Ga0075428_100648561 3300006844 Bacteria 1126
18 Ga0075430_100110695 3300006846 Bacteria 2290
19 Ga0075430_100190732 3300006846 Bacteria 1703
20 Ga0075431_100020608 3300006847 Bacteria 6738
21 Ga0075429_100030000 3300006880 Bacteria 4723
22 Ga0097620_100616050 3300006931 Bacteria 1178
23 Ga0105240_10112179 3300009093 Bacteria 3297
24 Ga0111539_10008771 3300009094 Bacteria 12821
25 Ga0111539_10046372 3300009094 Bacteria 5198
26 Ga0157373_10024881 3300013100 Bacteria 4335
27 Ga0157373_10089208 3300013100 Bacteria 2172
28 Ga0157370_10001049 3300013104 Bacteria 34805
29 Ga0157370_10149003 3300013104 Bacteria 2178
30 Ga0157376_10032935 3300014969 Unclassified 4167
31 Ga0163161_10194391 3300017792 Unclassified 1561
32 Ga0207652_10094032 3300025921 Bacteria 2639
33 Ga0207681_10313936 3300025923 Bacteria 1244
34 Ga0207664_10256731 3300025929 Bacteria 1527
35 Ga0207690_10137993 3300025932 Bacteria 1793
36 Ga0207708_10098789 3300026075 Bacteria 2257
37 Ga0209967_1003814 3300027364 Bacteria 1990
38 Ga0209981_1008169 3300027378 Bacteria 1418
39 Ga0209996_1002159 3300027395 Bacteria 2429
40 Ga0210000_1003040 3300027462 Bacteria 2405
41 Ga0210000_1011115 3300027462 Bacteria 1332
42 Ga0209995_1001946 3300027471 Bacteria 3233
43 Ga0209995_1002021 3300027471 Bacteria 3179
44 Ga0209968_1005651 3300027526 Bacteria 1879
45 Ga0209974_10007889 3300027876 Bacteria 3653
46 Ga0265332_10000013 3300031238 Bacteria 250095
47 Ga0265316_10010238 3300031344 Bacteria 8560
48 Ga0307509_10000006 3300031507 Bacteria 421538
49 Ga0307408_100065871 3300031548 Bacteria 2659
50 Ga0307410_10022329 3300031852 Unclassified 3909
51 Ga0307407_10012645 3300031903 Unclassified 4065
52 Ga0307407_10135189 3300031903 Bacteria 1583
53 Ga0307409_100000193 3300031995 Bacteria 23964
54 Ga0307416_100005323 3300032002 Bacteria 7891
55 Ga0307414_10002473 3300032004 Bacteria 9684
56 Ga0307411_10009752 3300032005 Bacteria 5074
57 Ga0307411_10160540 3300032005 Bacteria 1683
58 Ga0307411_10291116 3300032005 Bacteria 1305
59 Ga0307415_100001573 3300032126 Bacteria 11001
60 Ga0373928_0018155 3300035084 Bacteria 1455
61 Ga0395900_0074093 3300037418 Bacteria 3501
62 Ga0439431_0005850 3300041997 Bacteria 2716
63 Ga0439462_0012345 3300042015 Bacteria 2181
64 Ga0439434_0000817 3300042435 Bacteria 8967
65 Ga0439435_0000267 3300042436 Bacteria 7669
66 Ga0451577_0043151 3300042876 Bacteria 4040
67 Ga0451577_0104499 3300042876 Bacteria 2531
68 Ga0453684_0000824 3300044712 Bacteria 104740
69 Ga0453684_0088750 3300044712 Bacteria 3827
70 Ga0451576_0001961 3300045051 Bacteria 32770
71 Ga0451576_0030528 3300045051 Bacteria 5759
72 Ga0496108_0002023 3300048911 Bacteria 16235
73 Ga0496109_0003005 3300048912 Bacteria 14079
74 Ga0496109_0517093 3300048912 Bacteria 1127
75 Ga0496113_0416551 3300048916 Bacteria 1079
76 Ga0496114_0000903 3300048917 Bacteria 22210
77 Ga0496114_0001789 3300048917 Bacteria 16306
78 Ga0496114_0005197 3300048917 Bacteria 10160
79 Ga0496114_0211162 3300048917 Bacteria 1702
80 Ga0496115_0206033 3300048918 Unclassified 1625
81 Ga0501031_0002014 3300049568 Bacteria 12801
82 Ga0501031_0002587 3300049568 Bacteria 11534
83 Ga0501031_0009941 3300049568 Bacteria 6194
84 Ga0501031_0092089 3300049568 Bacteria 1978
85 Ga0501032_0000167 3300049569 Bacteria 53430
86 Ga0501032_0007810 3300049569 Bacteria 7798
87 Ga0501032_0014754 3300049569 Bacteria 5530
88 Ga0501032_0034479 3300049569 Bacteria 3464
89 Ga0501032_0225290 3300049569 Bacteria 1219
90 Ga0501033_0000280 3300049570 Bacteria 49197
91 Ga0501033_0000842 3300049570 Bacteria 28042
92 Ga0501033_0000933 3300049570 Bacteria 26702
93 Ga0501033_0003040 3300049570 Bacteria 13955
94 Ga0501034_0046089 3300049571 Bacteria 4405
95 Ga0501036_0000725 3300049572 Bacteria 24359
96 Ga0501036_0006797 3300049572 Bacteria 9292
97 Ga0501036_0006839 3300049572 Bacteria 9265
98 Ga0501036_0018715 3300049572 Bacteria 5808
99 Ga0501036_0097503 3300049572 Bacteria 2485
100 Ga0501036_0137196 3300049572 Bacteria 2065
101 Ga0501036_0145880 3300049572 Bacteria 1996
102 Ga0501037_0000255 3300049573 Bacteria 45740
103 Ga0501038_0000229 3300049574 Bacteria 47553
104 Ga0501038_0005802 3300049574 Bacteria 11436
105 Ga0501038_0017404 3300049574 Bacteria 6497
106 Ga0501038_0018931 3300049574 Bacteria 6213
107 Ga0501038_0026959 3300049574 Bacteria 5114
108 Ga0501038_0040764 3300049574 Bacteria 4051
109 Ga0501038_0040831 3300049574 Bacteria 4048
110 Ga0501038_0057503 3300049574 Bacteria 3339
111 Ga0501038_0134646 3300049574 Bacteria 2025
112 Ga0501038_0256078 3300049574 Bacteria 1384
113 Ga0501039_0002464 3300049575 Bacteria 13776
114 Ga0501039_0010513 3300049575 Bacteria 7053
115 Ga0501039_0018592 3300049575 Bacteria 5334
116 Ga0501039_0037565 3300049575 Bacteria 3738
117 Ga0501040_0000182 3300049576 Bacteria 35992
118 Ga0501040_0003112 3300049576 Bacteria 10753
119 Ga0501040_0004427 3300049576 Bacteria 9127
120 Ga0501040_0024457 3300049576 Bacteria 4054
121 Ga0501042_0000708 3300049578 Bacteria 18084
122 Ga0501042_0002443 3300049578 Bacteria 11406
123 Ga0501042_0147025 3300049578 Bacteria 1699
124 Ga0501043_0083095 3300049579 Bacteria 2518
125 Ga0501043_0108925 3300049579 Bacteria 2175
126 Ga0501043_0180929 3300049579 Bacteria 1642
127 Ga0501043_0232926 3300049579 Bacteria 1422
128 Ga0501043_0291677 3300049579 Unclassified 1248
129 Ga0501046_0000422 3300049580 Bacteria 42250
130 Ga0501046_0001766 3300049580 Bacteria 20653
131 Ga0501046_0045480 3300049580 Bacteria 3487
132 Ga0501046_0058437 3300049580 Bacteria 3023
133 Ga0501046_0164571 3300049580 Bacteria 1666
134 Ga0501047_0002269 3300049581 Bacteria 18404
135 Ga0501047_0013232 3300049581 Bacteria 7814
136 Ga0501048_0024179 3300049582 Bacteria 4435
137 Ga0501068_0000334 3300049584 Bacteria 23668
138 Ga0501071_0008563 3300049587 Bacteria 6763
139 Ga0501072_0001230 3300049588 Bacteria 19113
140 Ga0501075_0006140 3300049591 Bacteria 8256
141 Ga0501075_0095605 3300049591 Bacteria 2255
142 Ga0501076_0000969 3300049592 Bacteria 18809
143 Ga0501077_0014928 3300049593 Bacteria 4883
144 Ga0501079_0022522 3300049741 Bacteria 4832
145 Ga0501081_0003549 3300049743 Bacteria 9963
146 Ga0501280_000394 3300049776 Bacteria 10646
147 Ga0501035_0001015 3300049822 Bacteria 29579
148 Ga0501035_0002414 3300049822 Bacteria 18291
149 Ga0501035_0160561 3300049822 Bacteria 1945
150 Ga0501035_0232640 3300049822 Bacteria 1570
151 Ga0501044_0000296 3300049823 Bacteria 63089
152 Ga0501044_0000323 3300049823 Bacteria 60420
153 Ga0501044_0000514 3300049823 Bacteria 47072
154 Ga0501044_0001524 3300049823 Bacteria 27171
155 Ga0501044_0026853 3300049823 Bacteria 6094
156 Ga0501044_0035716 3300049823 Bacteria 5203
157 Ga0501044_0051968 3300049823 Bacteria 4225
158 Ga0501044_0065770 3300049823 Bacteria 3697
159 Ga0501044_0119005 3300049823 Bacteria 2644
160 Ga0501044_0154856 3300049823 Bacteria 2272
161 Ga0501045_0000237 3300049824 Bacteria 32030
162 nmdc:mga0qj67_134300_c1 3300050509 Bacteria 2005
163 nmdc:mga0qj67_8850_c1 3300050509 Bacteria 7470
164 nmdc:mga06r32_184657_c1 3300050510 Bacteria 2072
165 nmdc:mga08y16_18856_c1 3300050511 Bacteria 7268
166 Ga0501084_0028334 3300054114 Bacteria 4681
167 Ga0590074_018333 3300059423 Unclassified 1197
168 Ga0501082_0027463 3300060353 Bacteria 4899
169 Ga0530510_0000756 3300061734 Bacteria 20996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0517093 Ga0496109_0517093_27_902 288
2 3300049568 Ga0501031_0009941 Ga0501031_0009941_2102_3073 315
3 3300049569 Ga0501032_0034479 Ga0501032_0034479_384_1349 315
4 3300049569 Ga0501032_0225290 Ga0501032_0225290_11_982 315
5 3300049570 Ga0501033_0000842 Ga0501033_0000842_6723_7694 315
6 3300049571 Ga0501034_0046089 Ga0501034_0046089_952_1923 315
7 3300049572 Ga0501036_0006839 Ga0501036_0006839_6989_7960 315
8 3300049574 Ga0501038_0018931 Ga0501038_0018931_3122_4093 315
9 3300049575 Ga0501039_0018592 Ga0501039_0018592_2468_3439 315
10 3300049576 Ga0501040_0003112 Ga0501040_0003112_2794_3765 315
11 3300049578 Ga0501042_0002443 Ga0501042_0002443_3250_4221 315
12 3300049579 Ga0501043_0083095 Ga0501043_0083095_1537_2508 315
13 3300049580 Ga0501046_0045480 Ga0501046_0045480_1802_2773 315
14 3300049581 Ga0501047_0013232 Ga0501047_0013232_6126_7097 315
15 3300049822 Ga0501035_0160561 Ga0501035_0160561_29_1000 315
16 3300049823 Ga0501044_0051968 Ga0501044_0051968_1589_2560 315
17 3300049569 Ga0501032_0000167 Ga0501032_0000167_30873_31877 318
18 3300049572 Ga0501036_0000725 Ga0501036_0000725_13058_14062 318
19 3300049573 Ga0501037_0000255 Ga0501037_0000255_14198_15202 318
20 3300049574 Ga0501038_0000229 Ga0501038_0000229_15676_16680 318
21 3300049576 Ga0501040_0000182 Ga0501040_0000182_18000_19004 318
22 3300049578 Ga0501042_0000708 Ga0501042_0000708_15566_16570 318
23 3300049580 Ga0501046_0000422 Ga0501046_0000422_10401_11405 318
24 3300049581 Ga0501047_0002269 Ga0501047_0002269_1515_2519 318
25 3300049584 Ga0501068_0000334 Ga0501068_0000334_10212_11216 318
26 3300049823 Ga0501044_0000323 Ga0501044_0000323_30570_31574 318
27 3300049824 Ga0501045_0000237 Ga0501045_0000237_30849_31853 318
28 3300005367 Ga0070667_100400137 Ga0070667_1004001371 319
29 3300009093 Ga0105240_10112179 Ga0105240_101121792 319
30 3300006847 Ga0075431_100020608 Ga0075431_1000206083 320
31 3300014969 Ga0157376_10032935 Ga0157376_100329353 320
32 3300049572 Ga0501036_0145880 Ga0501036_0145880_685_1671 324
33 3300049576 Ga0501040_0024457 Ga0501040_0024457_2384_3370 324
34 3300049587 Ga0501071_0008563 Ga0501071_0008563_3850_4836 324
35 3300049588 Ga0501072_0001230 Ga0501072_0001230_2169_3155 324
36 3300049591 Ga0501075_0006140 Ga0501075_0006140_5398_6384 324
37 3300049592 Ga0501076_0000969 Ga0501076_0000969_17746_18732 324
38 3300049741 Ga0501079_0022522 Ga0501079_0022522_2609_3595 324
39 3300049743 Ga0501081_0003549 Ga0501081_0003549_1853_2839 324
40 3300054114 Ga0501084_0028334 Ga0501084_0028334_758_1744 324
41 3300059423 Ga0590074_018333 Ga0590074_018333_96_1109 324
42 3300060353 Ga0501082_0027463 Ga0501082_0027463_590_1576 324
43 3300061734 Ga0530510_0000756 Ga0530510_0000756_3784_4770 324
44 3300049574 Ga0501038_0026959 Ga0501038_0026959_1395_2417 325
45 3300045051 Ga0451576_0001961 Ga0451576_0001961_22463_23449 326
46 3300045051 Ga0451576_0030528 Ga0451576_0030528_3166_4152 326
47 iso_pu_bacteria 2547132512 2548846970 326
48 3300006844 Ga0075428_100648561 Ga0075428_1006485611 327
49 3300006846 Ga0075430_100190732 Ga0075430_1001907321 327
50 3300027364 Ga0209967_1003814 Ga0209967_10038142 327
51 3300027378 Ga0209981_1008169 Ga0209981_10081691 327
52 3300027395 Ga0209996_1002159 Ga0209996_10021593 327
53 3300027462 Ga0210000_1003040 Ga0210000_10030402 327
54 3300027471 Ga0209995_1002021 Ga0209995_10020214 327
55 3300027526 Ga0209968_1005651 Ga0209968_10056512 327
56 3300042435 Ga0439434_0000817 Ga0439434_0000817_5307_6302 327
57 3300042436 Ga0439435_0000267 Ga0439435_0000267_5292_6287 327
58 3300049576 Ga0501040_0004427 Ga0501040_0004427_7755_8750 327
59 3300049580 Ga0501046_0164571 Ga0501046_0164571_10_1005 327
60 3300049582 Ga0501048_0024179 Ga0501048_0024179_2814_3809 327
61 3300049822 Ga0501035_0232640 Ga0501035_0232640_213_1208 327
62 3300050509 nmdc:mga0qj67_134300_c1 nmdc:mga0qj67_134300_c1_826_1809 327
63 3300006844 Ga0075428_100012151 Ga0075428_1000121515 328
64 3300006846 Ga0075430_100110695 Ga0075430_1001106952 328
65 3300006880 Ga0075429_100030000 Ga0075429_1000300002 328
66 3300009094 Ga0111539_10046372 Ga0111539_100463722 328
67 3300031548 Ga0307408_100065871 Ga0307408_1000658713 328
68 3300031852 Ga0307410_10022329 Ga0307410_100223293 328
69 3300031903 Ga0307407_10012645 Ga0307407_100126452 328
70 3300031995 Ga0307409_100000193 Ga0307409_1000001936 328
71 3300032002 Ga0307416_100005323 Ga0307416_1000053235 328
72 3300032004 Ga0307414_10002473 Ga0307414_100024739 328
73 3300032005 Ga0307411_10009752 Ga0307411_100097522 328
74 3300032126 Ga0307415_100001573 Ga0307415_1000015733 328
75 3300049593 Ga0501077_0014928 Ga0501077_0014928_1167_2165 328
76 3300050509 nmdc:mga0qj67_8850_c1 nmdc:mga0qj67_8850_c1_5536_6522 328
77 3300050510 nmdc:mga06r32_184657_c1 nmdc:mga06r32_184657_c1_822_1808 328
78 3300005844 Ga0068862_100017080 Ga0068862_1000170804 329
79 3300031507 Ga0307509_10000006 Ga0307509_10000006335 329
80 3300031903 Ga0307407_10135189 Ga0307407_101351891 329
81 3300032005 Ga0307411_10291116 Ga0307411_102911161 329
82 3300049572 Ga0501036_0018715 Ga0501036_0018715_2423_3418 329
83 3300049578 Ga0501042_0147025 Ga0501042_0147025_107_1102 329
84 3300027462 Ga0210000_1011115 Ga0210000_10111151 330
85 3300027471 Ga0209995_1001946 Ga0209995_10019463 330
86 3300027876 Ga0209974_10007889 Ga0209974_100078892 330
87 3300031238 Ga0265332_10000013 Ga0265332_1000001311 330
88 3300041997 Ga0439431_0005850 Ga0439431_0005850_1535_2533 330
89 3300042015 Ga0439462_0012345 Ga0439462_0012345_406_1404 330
90 3300049569 Ga0501032_0007810 Ga0501032_0007810_6576_7568 330
91 3300049776 Ga0501280_000394 Ga0501280_000394_1272_2273 330
92 3300031344 Ga0265316_10010238 Ga0265316_100102381 331
93 3300035084 Ga0373928_0018155 Ga0373928_0018155_61_1062 331
94 3300042876 Ga0451577_0043151 Ga0451577_0043151_1098_2099 331
95 3300044712 Ga0453684_0000824 Ga0453684_0000824_39803_40804 331
96 3300044712 Ga0453684_0088750 Ga0453684_0088750_1028_2029 331
97 3300049572 Ga0501036_0137196 Ga0501036_0137196_1043_2044 331
98 3300049591 Ga0501075_0095605 Ga0501075_0095605_775_1776 331
99 3300005353 Ga0070669_100284298 Ga0070669_1002842981 332
100 3300005356 Ga0070674_100282824 Ga0070674_1002828242 332
101 3300005617 Ga0068859_100616020 Ga0068859_1006160201 332
102 3300005937 Ga0081455_10112065 Ga0081455_101120652 332
103 3300006931 Ga0097620_100616050 Ga0097620_1006160501 332
104 3300025923 Ga0207681_10313936 Ga0207681_103139361 332
105 3300049574 Ga0501038_0256078 Ga0501038_0256078_134_1132 332
106 3300009094 Ga0111539_10008771 Ga0111539_100087718 333
107 3300025932 Ga0207690_10137993 Ga0207690_101379932 333
108 3300032005 Ga0307411_10160540 Ga0307411_101605402 333
109 3300048911 Ga0496108_0002023 Ga0496108_0002023_5389_6390 333
110 3300048912 Ga0496109_0003005 Ga0496109_0003005_7392_8393 333
111 3300048916 Ga0496113_0416551 Ga0496113_0416551_30_1031 333
112 3300048917 Ga0496114_0001789 Ga0496114_0001789_5187_6188 333
113 3300049570 Ga0501033_0000933 Ga0501033_0000933_1941_3113 333
114 3300049572 Ga0501036_0006797 Ga0501036_0006797_5197_6198 333
115 3300049574 Ga0501038_0017404 Ga0501038_0017404_107_1108 333
116 3300049574 Ga0501038_0057503 Ga0501038_0057503_1334_2506 333
117 3300049823 Ga0501044_0000296 Ga0501044_0000296_10959_11987 333
118 3300049823 Ga0501044_0000514 Ga0501044_0000514_37901_38902 333
119 3300049823 Ga0501044_0026853 Ga0501044_0026853_3792_4964 333
120 3300050511 nmdc:mga08y16_18856_c1 nmdc:mga08y16_18856_c1_6238_7239 333
121 3300005339 Ga0070660_100305331 Ga0070660_1003053312 334
122 3300005366 Ga0070659_100241929 Ga0070659_1002419291 334
123 3300005435 Ga0070714_100003989 Ga0070714_1000039896 334
124 3300005435 Ga0070714_100028842 Ga0070714_1000288422 334
125 3300005457 Ga0070662_100175730 Ga0070662_1001757301 334
126 3300005467 Ga0070706_100299688 Ga0070706_1002996881 334
127 3300005518 Ga0070699_100242508 Ga0070699_1002425082 334
128 3300005530 Ga0070679_100044920 Ga0070679_1000449202 334
129 3300005539 Ga0068853_100245127 Ga0068853_1002451271 334
130 3300013100 Ga0157373_10024881 Ga0157373_100248815 334
131 3300013100 Ga0157373_10089208 Ga0157373_100892082 334
132 3300013104 Ga0157370_10001049 Ga0157370_1000104919 334
133 3300013104 Ga0157370_10149003 Ga0157370_101490031 334
134 3300017792 Ga0163161_10194391 Ga0163161_101943912 334
135 3300025921 Ga0207652_10094032 Ga0207652_100940322 334
136 3300025929 Ga0207664_10256731 Ga0207664_102567311 334
137 3300026075 Ga0207708_10098789 Ga0207708_100987892 334
138 3300037418 Ga0395900_0074093 Ga0395900_0074093_1558_2574 334
139 3300042876 Ga0451577_0104499 Ga0451577_0104499_741_1766 334
140 3300048917 Ga0496114_0000903 Ga0496114_0000903_2252_3280 334
141 3300048917 Ga0496114_0005197 Ga0496114_0005197_2799_3803 334
142 3300048917 Ga0496114_0211162 Ga0496114_0211162_324_1328 334
143 3300048918 Ga0496115_0206033 Ga0496115_0206033_545_1549 334
144 3300049568 Ga0501031_0002014 Ga0501031_0002014_11252_12280 334
145 3300049568 Ga0501031_0002587 Ga0501031_0002587_2431_3435 334
146 3300049568 Ga0501031_0092089 Ga0501031_0092089_781_1806 334
147 3300049569 Ga0501032_0014754 Ga0501032_0014754_1232_2236 334
148 3300049570 Ga0501033_0000280 Ga0501033_0000280_46792_47796 334
149 3300049570 Ga0501033_0003040 Ga0501033_0003040_11148_12152 334
150 3300049572 Ga0501036_0097503 Ga0501036_0097503_1293_2321 334
151 3300049574 Ga0501038_0005802 Ga0501038_0005802_8285_9313 334
152 3300049574 Ga0501038_0040764 Ga0501038_0040764_1043_2062 334
153 3300049574 Ga0501038_0040831 Ga0501038_0040831_807_1829 334
154 3300049574 Ga0501038_0134646 Ga0501038_0134646_182_1186 334
155 3300049575 Ga0501039_0002464 Ga0501039_0002464_1486_2514 334
156 3300049575 Ga0501039_0010513 Ga0501039_0010513_2046_3068 334
157 3300049575 Ga0501039_0037565 Ga0501039_0037565_1912_2928 334
158 3300049579 Ga0501043_0108925 Ga0501043_0108925_840_1844 334
159 3300049579 Ga0501043_0180929 Ga0501043_0180929_43_1071 334
160 3300049579 Ga0501043_0232926 Ga0501043_0232926_216_1220 334
161 3300049579 Ga0501043_0291677 Ga0501043_0291677_21_1043 334
162 3300049580 Ga0501046_0001766 Ga0501046_0001766_19610_20614 334
163 3300049580 Ga0501046_0058437 Ga0501046_0058437_718_1740 334
164 3300049822 Ga0501035_0001015 Ga0501035_0001015_6127_7149 334
165 3300049822 Ga0501035_0002414 Ga0501035_0002414_16984_17988 334
166 3300049823 Ga0501044_0001524 Ga0501044_0001524_22115_23137 334
167 3300049823 Ga0501044_0035716 Ga0501044_0035716_1155_2159 334
168 3300049823 Ga0501044_0065770 Ga0501044_0065770_573_1601 334
169 3300049823 Ga0501044_0119005 Ga0501044_0119005_138_1142 334
170 3300049823 Ga0501044_0154856 Ga0501044_0154856_327_1346 334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12727

PBP_like

PBP superfamily domain

99

331

0.84

PF12849

PBP_like_2

PBP superfamily domain

71

334

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8756 32 291
1twy-assembly10.cif.gz_B crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8622 32 291
1twy-assembly11.cif.gz_F crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8525 30 292
1twy-assembly11.cif.gz_F crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8462 30 292
1twy-assembly1.cif.gz_A crystal structure of an abc-type phosphate transport receptor from vibrio cholerae 0.8406 30 291
ID Description Score Start End Superfamily
af_Q2FYP6_33_111_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9491 30 101 3.40.190.10
4jwoA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9457 112 254 3.40.190.10
4jwoA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9392 112 254 3.40.190.10
4jwoA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9363 29 307 3.40.190.10
af_Q2FYP6_116_251_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9167 112 254 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A658NGR2-F1-model_v4 Protein sphX 0.9913 30 108
AF-A0A658NGR2-F1-model_v4 Protein sphX 0.979 30 108
AF-A0A850QIU8-F1-model_v4 Substrate-binding domain-containing protein 0.964 128 334
AF-A0A7C3Q0K4-F1-model_v4 Protein sphX 0.9638 128 334
AF-A0A850QIU8-F1-model_v4 Substrate-binding domain-containing protein 0.9506 128 334

Feature Viewer

pLDDT pTM Quality
88.77 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map