F257435

General Info

Members Datasets Scaffolds Average Seq Length
170 124 161 146

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0076416|Ga0495659_0076416_533_1051
Length 172
Sequence MTARGALWHDCCGAPFSISATEGVGMNANIDFHQFVDAVGDSVIVCDAAGAITVWNPASTRIFGFTAEEALGQSLDLIIPERQRQRHWDGYHKTMATGETRYGSDLLRVPALHKEGKPLSIAFTVAMLHDPDGKVSAIIAIVRDETARWTEERGLKTKLAQLEAKAAATASE

Samples

Sample ID Description Type Environment
1 2738543013 Variovorax sp. BT01 Isolate Unclassified
2 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
3 2818991436 Collimonas arenae 515 Isolate Unclassified
4 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
5 2899924645 Variovorax sp. 369 Isolate Unclassified
6 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
7 2928051484 Variovorax sp. 1133 Isolate Unclassified
8 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
9 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
26 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
27 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
28 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
30 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
31 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
35 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
36 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
37 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
42 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
43 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
44 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
45 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
46 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
47 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
48 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
49 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
50 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
51 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
54 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
60 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
61 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
62 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
63 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
64 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
65 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
66 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
73 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
74 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
75 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
76 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
77 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
78 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
79 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
80 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
99 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
100 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
107 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
115 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
116 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
117 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
121 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
122 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.53
Metatranscriptomes 1.18
Isolates 5.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.88
Nodule 0
Rhizoplane 7.06
Rhizosphere 70
Stem 0
Stem Tuber 0
Unclassified 7.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1044422 3300002987 Bacteria 633
2 JGI25151J46595_10010119 3300003187 Bacteria 4408
3 Ga0055536_1014624 3300003781 Bacteria 2737
4 Ga0055534_1002739 3300003784 Bacteria 5920
5 Ga0055530_10055245 3300003791 Bacteria 905
6 Ga0055540_1031439 3300003792 Bacteria 1219
7 Ga0055531_10055232 3300003794 Bacteria 1011
8 Ga0065715_10101838 3300005293 Bacteria 3166
9 Ga0070674_100998820 3300005356 Bacteria 734
10 Ga0070673_101233075 3300005364 Unclassified 701
11 Ga0070717_10198775 3300006028 Bacteria 1755
12 Ga0075364_10339594 3300006051 Bacteria 1023
13 Ga0075367_10113150 3300006178 Bacteria 1667
14 Ga0075366_10110304 3300006195 Bacteria 1654
15 Ga0075370_10152333 3300006353 Bacteria 1355
16 Ga0157371_10189613 3300013102 Bacteria 1472
17 Ga0157372_10048628 3300013307 Bacteria 4714
18 Ga0209130_1013957 3300025284 Bacteria 2036
19 Ga0209675_1001002 3300025291 Bacteria 17764
20 Ga0209025_1000286 3300025294 Bacteria 114096
21 Ga0209025_1092398 3300025294 Bacteria 985
22 Ga0209758_1153751 3300025297 Bacteria 580
23 Ga0209050_1038038 3300025298 Bacteria 1378
24 Ga0209051_1049966 3300025303 Bacteria 1404
25 Ga0209257_1019135 3300025304 Bacteria 2594
26 Ga0307515_10504607 3300028794 Bacteria 820
27 Ga0265338_10001739 3300028800 Bacteria 34426
28 Ga0316178_1087173 3300030735 Bacteria 3065
29 Ga0307513_10254084 3300031456 Bacteria 1552
30 Ga0307408_102278674 3300031548 Bacteria 524
31 Ga0316579_10007593 3300031691 Bacteria 4486
32 Ga0316578_10033638 3300031728 Bacteria 2939
33 Ga0307405_12043137 3300031731 Bacteria 513
34 Ga0316593_10008286 3300032168 Bacteria 2892
35 Ga0316574_0021455 3300035398 Bacteria 3836
36 Ga0316582_0254143 3300036647 Bacteria 1204
37 Ga0316584_0009763 3300036712 Bacteria 6677
38 Ga0395905_0165289 3300037471 Bacteria 2079
39 Ga0395905_0190629 3300037471 Bacteria 1923
40 Ga0395905_0238430 3300037471 Bacteria 1700
41 Ga0395905_1041960 3300037471 Bacteria 721
42 Ga0316581_0044635 3300037588 Bacteria 1353
43 Ga0395901_0116460 3300038443 Bacteria 2807
44 Ga0439441_094161 3300042001 Bacteria 665
45 Ga0439457_112406 3300042014 Bacteria 640
46 Ga0439435_0174785 3300042436 Bacteria 699
47 Ga0466972_0081638 3300044658 Bacteria 1539
48 Ga0466981_0125988 3300044669 Bacteria 1787
49 Ga0466982_0182732 3300044672 Bacteria 1267
50 Ga0466970_0005540 3300044765 Bacteria 6271
51 Ga0495617_001092 3300046452 Bacteria 12333
52 Ga0495629_0011620 3300046459 Bacteria 6392
53 Ga0495651_0001846 3300046462 Bacteria 16381
54 Ga0495650_0000383 3300046471 Bacteria 75998
55 Ga0495605_0157614 3300046474 Bacteria 1009
56 Ga0495605_0178760 3300046474 Bacteria 934
57 Ga0495584_0006066 3300046491 Bacteria 6362
58 Ga0495584_0031769 3300046491 Bacteria 2672
59 Ga0495585_0000911 3300046492 Bacteria 25062
60 Ga0495596_0000801 3300046500 Bacteria 19061
61 Ga0495607_0159320 3300046501 Bacteria 1148
62 Ga0495583_0000549 3300046506 Bacteria 52554
63 Ga0495583_0027498 3300046506 Bacteria 2807
64 Ga0495583_0131531 3300046506 Bacteria 1047
65 Ga0495606_0000059 3300046507 Bacteria 186886
66 Ga0495606_0000987 3300046507 Bacteria 41467
67 Ga0495606_0002140 3300046507 Bacteria 23813
68 Ga0495608_0324663 3300046511 Bacteria 950
69 Ga0495618_0350927 3300046514 Bacteria 909
70 Ga0495628_0000037 3300046516 Bacteria 109854
71 Ga0495631_0000752 3300046518 Bacteria 20761
72 Ga0495631_0003919 3300046518 Bacteria 8038
73 Ga0495637_0010584 3300046520 Bacteria 4454
74 Ga0495637_0055262 3300046520 Bacteria 1647
75 Ga0495643_0000099 3300046522 Bacteria 145425
76 Ga0495643_0006913 3300046522 Bacteria 7387
77 Ga0495643_0016456 3300046522 Bacteria 4343
78 Ga0495643_0037896 3300046522 Bacteria 2642
79 Ga0495648_0016402 3300046524 Bacteria 5344
80 Ga0495648_0016846 3300046524 Bacteria 5252
81 Ga0495648_0475085 3300046524 Bacteria 541
82 Ga0495663_0046997 3300046525 Bacteria 1327
83 Ga0495642_0051269 3300046528 Bacteria 1697
84 Ga0495642_0065382 3300046528 Bacteria 1514
85 Ga0495652_0001293 3300046529 Bacteria 27959
86 Ga0495598_0127451 3300046537 Bacteria 869
87 Ga0495609_0000582 3300046538 Bacteria 28727
88 Ga0495609_0051922 3300046538 Bacteria 1824
89 Ga0495621_0027468 3300046539 Bacteria 1927
90 Ga0495597_0009469 3300046542 Bacteria 4808
91 Ga0495597_0022080 3300046542 Bacteria 2954
92 Ga0495597_0029052 3300046542 Bacteria 2526
93 Ga0495633_0002572 3300046558 Bacteria 12716
94 Ga0495633_0003843 3300046558 Bacteria 9818
95 Ga0495656_0004519 3300046615 Bacteria 4766
96 Ga0495656_0017797 3300046615 Bacteria 2718
97 Ga0495668_0018677 3300046616 Bacteria 4007
98 Ga0495668_0039869 3300046616 Bacteria 2621
99 Ga0495611_0105703 3300046648 Bacteria 1309
100 Ga0495611_0408394 3300046648 Bacteria 620
101 Ga0495659_0076416 3300046664 Bacteria 1263
102 Ga0495661_0000603 3300046665 Bacteria 36732
103 Ga0495661_0015948 3300046665 Bacteria 4998
104 Ga0495588_0009212 3300046674 Bacteria 4559
105 Ga0495623_0024438 3300046679 Bacteria 3893
106 Ga0495670_0000525 3300046691 Bacteria 18162
107 Ga0495670_0081657 3300046691 Bacteria 1647
108 Ga0495649_0024823 3300046694 Bacteria 3342
109 Ga0495660_0002744 3300046810 Bacteria 11106
110 Ga0495636_0009388 3300047318 Bacteria 3852
111 Ga0495636_0099248 3300047318 Bacteria 1271
112 Ga0495636_0183270 3300047318 Bacteria 951
113 Ga0495636_0429037 3300047318 Bacteria 633
114 Ga0495674_0009477 3300047319 Bacteria 9251
115 Ga0495672_0000257 3300047320 Bacteria 74176
116 Ga0495672_0000277 3300047320 Bacteria 71082
117 Ga0495672_0200067 3300047320 Bacteria 999
118 Ga0495672_0410070 3300047320 Bacteria 618
119 Ga0495676_0052890 3300047321 Bacteria 3239
120 Ga0495683_0051486 3300047323 Bacteria 2058
121 Ga0495683_0087271 3300047323 Bacteria 1515
122 Ga0495687_019776 3300047443 Bacteria 3294
123 Ga0495687_262437 3300047443 Bacteria 509
124 Ga0495677_0002147 3300047445 Bacteria 7806
125 Ga0495685_050654 3300047447 Bacteria 1409
126 Ga0495673_0000059 3300047469 Bacteria 233234
127 Ga0495673_0220826 3300047469 Bacteria 701
128 Ga0495681_0006741 3300047470 Bacteria 7485
129 Ga0495686_0000456 3300047472 Bacteria 61394
130 Ga0495686_0001547 3300047472 Bacteria 24575
131 Ga0495686_0052866 3300047472 Bacteria 2546
132 Ga0495686_0224936 3300047472 Bacteria 1065
133 Ga0495602_0052241 3300048088 Bacteria 3632
134 Ga0495615_0000668 3300048090 Bacteria 4809
135 Ga0495626_0044668 3300048091 Bacteria 2072
136 Ga0495626_0062138 3300048091 Bacteria 1697
137 Ga0496102_0001051 3300048905 Bacteria 25540
138 Ga0496102_0025755 3300048905 Bacteria 5238
139 Ga0496102_0068535 3300048905 Bacteria 3255
140 Ga0496102_0172310 3300048905 Bacteria 2037
141 Ga0496103_0087996 3300048906 Bacteria 1958
142 Ga0496103_0123189 3300048906 Bacteria 1652
143 Ga0496104_0114760 3300048907 Bacteria 2584
144 Ga0496106_0211764 3300048909 Bacteria 1544
145 Ga0496108_0036025 3300048911 Bacteria 4115
146 Ga0496109_0119806 3300048912 Bacteria 2451
147 Ga0496110_0129152 3300048913 Bacteria 2281
148 Ga0496114_0349793 3300048917 Bacteria 1307
149 Ga0496124_0259900 3300048927 Bacteria 1278
150 Ga0496125_0073373 3300048928 Bacteria 2661
151 Ga0495678_000165 3300049459 Bacteria 77667
152 Ga0501235_023368 3300049669 Bacteria 1378
153 nmdc:mga00v17_657322_c1 3300050491 Bacteria 674
154 nmdc:mga0k408_429616_c1 3300050493 Bacteria 785
155 nmdc:mga07m45_173484_c1 3300050496 Bacteria 1254
156 Ga0500594_0000484 3300053118 Bacteria 8716
157 Ga0500594_0262668 3300053118 Bacteria 576
158 Ga0500618_000085 3300053125 Bacteria 75760
159 Ga0500618_016064 3300053125 Bacteria 1880
160 Ga0500658_0487406 3300053134 Bacteria 559
161 Ga0587111_0008571 3300060346 Bacteria 1699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2897803580 2897808010 138
2 iso_pu_bacteria 2738543013 2739248038 139
3 iso_pu_bacteria 2808606418 2809146319 139
4 3300046459 Ga0495629_0011620 Ga0495629_0011620_5001_5423 140
5 3300046491 Ga0495584_0031769 Ga0495584_0031769_1642_2064 140
6 3300046492 Ga0495585_0000911 Ga0495585_0000911_3985_4407 140
7 3300046500 Ga0495596_0000801 Ga0495596_0000801_105_527 140
8 3300046518 Ga0495631_0003919 Ga0495631_0003919_1617_2039 140
9 3300046522 Ga0495643_0016456 Ga0495643_0016456_1683_2105 140
10 3300046538 Ga0495609_0051922 Ga0495609_0051922_904_1326 140
11 3300046648 Ga0495611_0408394 Ga0495611_0408394_62_484 140
12 3300046691 Ga0495670_0081657 Ga0495670_0081657_177_599 140
13 3300047318 Ga0495636_0429037 Ga0495636_0429037_125_547 140
14 3300047319 Ga0495674_0009477 Ga0495674_0009477_4053_4475 140
15 3300047320 Ga0495672_0200067 Ga0495672_0200067_255_677 140
16 3300047321 Ga0495676_0052890 Ga0495676_0052890_2245_2667 140
17 3300048091 Ga0495626_0062138 Ga0495626_0062138_750_1172 140
18 3300025297 Ga0209758_1153751 Ga0209758_11537512 141
19 3300006028 Ga0070717_10198775 Ga0070717_101987752 142
20 3300006195 Ga0075366_10110304 Ga0075366_101103043 142
21 3300031691 Ga0316579_10007593 Ga0316579_100075933 142
22 3300031728 Ga0316578_10033638 Ga0316578_100336383 142
23 3300032168 Ga0316593_10008286 Ga0316593_100082863 142
24 3300035398 Ga0316574_0021455 Ga0316574_0021455_848_1276 142
25 3300036647 Ga0316582_0254143 Ga0316582_0254143_137_565 142
26 3300036712 Ga0316584_0009763 Ga0316584_0009763_4257_4685 142
27 3300037471 Ga0395905_1041960 Ga0395905_1041960_128_556 142
28 3300037588 Ga0316581_0044635 Ga0316581_0044635_441_869 142
29 3300042001 Ga0439441_094161 Ga0439441_094161_206_634 142
30 3300042436 Ga0439435_0174785 Ga0439435_0174785_208_669 142
31 3300046462 Ga0495651_0001846 Ga0495651_0001846_8279_8707 142
32 3300046507 Ga0495606_0002140 Ga0495606_0002140_8027_8458 142
33 3300046511 Ga0495608_0324663 Ga0495608_0324663_149_577 142
34 3300046514 Ga0495618_0350927 Ga0495618_0350927_171_599 142
35 3300046516 Ga0495628_0000037 Ga0495628_0000037_106238_106666 142
36 3300046529 Ga0495652_0001293 Ga0495652_0001293_199_627 142
37 3300046679 Ga0495623_0024438 Ga0495623_0024438_726_1154 142
38 3300048088 Ga0495602_0052241 Ga0495602_0052241_849_1277 142
39 3300048927 Ga0496124_0259900 Ga0496124_0259900_821_1249 142
40 3300050493 nmdc:mga0k408_429616_c1 nmdc:mga0k408_429616_c1_181_642 142
41 3300060346 Ga0587111_0008571 Ga0587111_0008571_190_618 142
42 3300005356 Ga0070674_100998820 Ga0070674_1009988202 143
43 3300005364 Ga0070673_101233075 Ga0070673_1012330751 143
44 3300028800 Ga0265338_10001739 Ga0265338_100017396 143
45 3300037471 Ga0395905_0190629 Ga0395905_0190629_266_697 143
46 3300037471 Ga0395905_0238430 Ga0395905_0238430_1215_1646 143
47 3300038443 Ga0395901_0116460 Ga0395901_0116460_2008_2439 143
48 3300044669 Ga0466981_0125988 Ga0466981_0125988_1118_1549 143
49 3300044672 Ga0466982_0182732 Ga0466982_0182732_638_1069 143
50 3300044765 Ga0466970_0005540 Ga0466970_0005540_5526_5957 143
51 3300046471 Ga0495650_0000383 Ga0495650_0000383_18968_19399 143
52 3300046474 Ga0495605_0157614 Ga0495605_0157614_52_483 143
53 3300046474 Ga0495605_0178760 Ga0495605_0178760_12_443 143
54 3300046491 Ga0495584_0006066 Ga0495584_0006066_1294_1725 143
55 3300046506 Ga0495583_0131531 Ga0495583_0131531_437_868 143
56 3300046518 Ga0495631_0000752 Ga0495631_0000752_16356_16787 143
57 3300046520 Ga0495637_0055262 Ga0495637_0055262_55_525 143
58 3300046522 Ga0495643_0006913 Ga0495643_0006913_3665_4096 143
59 3300046524 Ga0495648_0016402 Ga0495648_0016402_1572_2003 143
60 3300046528 Ga0495642_0051269 Ga0495642_0051269_862_1293 143
61 3300046538 Ga0495609_0000582 Ga0495609_0000582_18042_18473 143
62 3300046542 Ga0495597_0009469 Ga0495597_0009469_18_449 143
63 3300046542 Ga0495597_0022080 Ga0495597_0022080_328_759 143
64 3300046558 Ga0495633_0002572 Ga0495633_0002572_8264_8695 143
65 3300046616 Ga0495668_0018677 Ga0495668_0018677_1419_1850 143
66 3300046616 Ga0495668_0039869 Ga0495668_0039869_87_518 143
67 3300046648 Ga0495611_0105703 Ga0495611_0105703_481_912 143
68 3300046665 Ga0495661_0000603 Ga0495661_0000603_19751_20182 143
69 3300046665 Ga0495661_0015948 Ga0495661_0015948_3534_3965 143
70 3300046691 Ga0495670_0000525 Ga0495670_0000525_16333_16764 143
71 3300047320 Ga0495672_0000257 Ga0495672_0000257_16984_17415 143
72 3300047323 Ga0495683_0051486 Ga0495683_0051486_808_1239 143
73 3300047323 Ga0495683_0087271 Ga0495683_0087271_887_1318 143
74 3300047443 Ga0495687_019776 Ga0495687_019776_1447_1878 143
75 3300047445 Ga0495677_0002147 Ga0495677_0002147_3351_3782 143
76 3300047470 Ga0495681_0006741 Ga0495681_0006741_5751_6182 143
77 3300047472 Ga0495686_0000456 Ga0495686_0000456_39092_39523 143
78 3300047472 Ga0495686_0052866 Ga0495686_0052866_1998_2453 143
79 3300048091 Ga0495626_0044668 Ga0495626_0044668_442_912 143
80 3300053118 Ga0500594_0262668 Ga0500594_0262668_74_505 143
81 3300053125 Ga0500618_000085 Ga0500618_000085_53811_54242 143
82 3300053134 Ga0500658_0487406 Ga0500658_0487406_50_490 143
83 iso_pu_bacteria 2818991436 2819541810 143
84 iso_pu_bacteria 2904541872 2904547084 143
85 iso_pu_bacteria 2929160207 2929165620 143
86 3300005293 Ga0065715_10101838 Ga0065715_101018382 144
87 3300044658 Ga0466972_0081638 Ga0466972_0081638_37_477 144
88 3300046506 Ga0495583_0027498 Ga0495583_0027498_1384_1818 144
89 3300046524 Ga0495648_0475085 Ga0495648_0475085_54_488 144
90 3300046537 Ga0495598_0127451 Ga0495598_0127451_159_593 144
91 3300046539 Ga0495621_0027468 Ga0495621_0027468_1148_1582 144
92 3300047318 Ga0495636_0009388 Ga0495636_0009388_1360_1794 144
93 3300048905 Ga0496102_0025755 Ga0496102_0025755_1224_1658 144
94 3300048905 Ga0496102_0068535 Ga0496102_0068535_2016_2450 144
95 3300048905 Ga0496102_0172310 Ga0496102_0172310_1309_1743 144
96 3300048906 Ga0496103_0123189 Ga0496103_0123189_391_825 144
97 3300048907 Ga0496104_0114760 Ga0496104_0114760_1395_1829 144
98 3300048909 Ga0496106_0211764 Ga0496106_0211764_926_1360 144
99 3300048911 Ga0496108_0036025 Ga0496108_0036025_3127_3561 144
100 3300048912 Ga0496109_0119806 Ga0496109_0119806_1340_1774 144
101 3300048913 Ga0496110_0129152 Ga0496110_0129152_1148_1582 144
102 3300048917 Ga0496114_0349793 Ga0496114_0349793_695_1129 144
103 3300006051 Ga0075364_10339594 Ga0075364_103395942 145
104 3300006178 Ga0075367_10113150 Ga0075367_101131502 145
105 3300006353 Ga0075370_10152333 Ga0075370_101523332 145
106 3300030735 Ga0316178_1087173 Ga0316178_10871733 145
107 3300031548 Ga0307408_102278674 Ga0307408_1022786741 145
108 3300031731 Ga0307405_12043137 Ga0307405_120431371 145
109 3300037471 Ga0395905_0165289 Ga0395905_0165289_1207_1644 145
110 3300042014 Ga0439457_112406 Ga0439457_112406_85_522 145
111 3300046528 Ga0495642_0065382 Ga0495642_0065382_242_679 145
112 3300046674 Ga0495588_0009212 Ga0495588_0009212_3225_3662 145
113 3300046694 Ga0495649_0024823 Ga0495649_0024823_2686_3123 145
114 3300047443 Ga0495687_262437 Ga0495687_262437_57_494 145
115 3300047469 Ga0495673_0000059 Ga0495673_0000059_145174_145611 145
116 3300047469 Ga0495673_0220826 Ga0495673_0220826_116_553 145
117 3300050491 nmdc:mga00v17_657322_c1 nmdc:mga00v17_657322_c1_189_626 145
118 3300050496 nmdc:mga07m45_173484_c1 nmdc:mga07m45_173484_c1_300_737 145
119 3300053118 Ga0500594_0000484 Ga0500594_0000484_5218_5655 145
120 3300028794 Ga0307515_10504607 Ga0307515_105046072 146
121 3300046452 Ga0495617_001092 Ga0495617_001092_5345_5791 146
122 3300046507 Ga0495606_0000059 Ga0495606_0000059_103020_103466 146
123 3300046507 Ga0495606_0000987 Ga0495606_0000987_14556_14996 146
124 3300046520 Ga0495637_0010584 Ga0495637_0010584_522_968 146
125 3300046522 Ga0495643_0000099 Ga0495643_0000099_71386_71829 146
126 3300046558 Ga0495633_0003843 Ga0495633_0003843_1380_1823 146
127 3300046810 Ga0495660_0002744 Ga0495660_0002744_5199_5639 146
128 3300047320 Ga0495672_0000277 Ga0495672_0000277_59303_59746 146
129 3300047472 Ga0495686_0001547 Ga0495686_0001547_14652_15092 146
130 3300047472 Ga0495686_0224936 Ga0495686_0224936_424_864 146
131 3300049459 Ga0495678_000165 Ga0495678_000165_75055_75498 146
132 3300049669 Ga0501235_023368 Ga0501235_023368_189_629 146
133 3300053125 Ga0500618_016064 Ga0500618_016064_236_679 146
134 3300003187 JGI25151J46595_10010119 JGI25151J46595_100101194 147
135 3300013102 Ga0157371_10189613 Ga0157371_101896132 147
136 3300013307 Ga0157372_10048628 Ga0157372_100486283 147
137 3300025294 Ga0209025_1000286 Ga0209025_100028672 147
138 3300031456 Ga0307513_10254084 Ga0307513_102540842 147
139 3300046501 Ga0495607_0159320 Ga0495607_0159320_562_1011 147
140 3300046506 Ga0495583_0000549 Ga0495583_0000549_24209_24655 147
141 3300046522 Ga0495643_0037896 Ga0495643_0037896_2104_2547 147
142 3300046524 Ga0495648_0016846 Ga0495648_0016846_703_1146 147
143 3300046525 Ga0495663_0046997 Ga0495663_0046997_773_1216 147
144 3300046542 Ga0495597_0029052 Ga0495597_0029052_972_1415 147
145 3300046615 Ga0495656_0004519 Ga0495656_0004519_538_981 147
146 3300046615 Ga0495656_0017797 Ga0495656_0017797_1820_2272 147
147 3300046664 Ga0495659_0076416 Ga0495659_0076416_533_1051 147
148 3300047318 Ga0495636_0099248 Ga0495636_0099248_122_565 147
149 3300047318 Ga0495636_0183270 Ga0495636_0183270_334_777 147
150 3300047447 Ga0495685_050654 Ga0495685_050654_85_528 147
151 3300048090 Ga0495615_0000668 Ga0495615_0000668_2675_3118 147
152 3300048905 Ga0496102_0001051 Ga0496102_0001051_22014_22457 147
153 3300048906 Ga0496103_0087996 Ga0496103_0087996_1091_1534 147
154 3300048928 Ga0496125_0073373 Ga0496125_0073373_1593_2039 147
155 iso_pu_bacteria 2899924645 2899930802 147
156 iso_pu_bacteria 2928051484 2928055609 147
157 iso_pu_bacteria 2928064002 2928069706 147
158 3300047320 Ga0495672_0410070 Ga0495672_0410070_99_545 148
159 3300002987 JGI25159J45721_1044422 JGI25159J45721_10444221 159
160 3300003781 Ga0055536_1014624 Ga0055536_10146243 159
161 3300003784 Ga0055534_1002739 Ga0055534_10027397 159
162 3300003791 Ga0055530_10055245 Ga0055530_100552452 159
163 3300003792 Ga0055540_1031439 Ga0055540_10314392 159
164 3300003794 Ga0055531_10055232 Ga0055531_100552322 159
165 3300025284 Ga0209130_1013957 Ga0209130_10139572 159
166 3300025291 Ga0209675_1001002 Ga0209675_100100215 159
167 3300025294 Ga0209025_1092398 Ga0209025_10923981 159
168 3300025298 Ga0209050_1038038 Ga0209050_10380382 159
169 3300025303 Ga0209051_1049966 Ga0209051_10499662 159
170 3300025304 Ga0209257_1019135 Ga0209257_10191353 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08448

PAS_4

PAS fold

36

149

0.94

PF00989

PAS

PAS fold

30

144

0.92

PF08447

PAS_3

PAS fold

52

142

0.91

PF13426

PAS_9

PAS domain

40

147

0.9

PF13188

PAS_8

PAS domain

31

93

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vb6-assembly1.cif.gz_B crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form) 0.9084 19 131
1v9y-assembly1.cif.gz_B crystal structure of the heme pas sensor domain of ec dos (ferric form) 0.9065 19 131
3lyx-assembly1.cif.gz_A crystal structure of the pas domain of the protein cps_1291 from colwellia psychrerythraea. northeast structural genomics consortium target id csr222b 0.8998 19 134
1vb6-assembly1.cif.gz_A crystal structure of the heme pas sensor domain of ec dos (oxygen-bound form) 0.8915 19 131
2vv6-assembly1.cif.gz_A bjfixlh in ferric form 0.8908 28 131
ID Description Score Start End Superfamily
1v9yB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9065 19 131 3.30.450.20
af_P38097_298_430_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.9 19 147 3.30.450.20
3lyxA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8998 19 134 3.30.450.20
1xj6A00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8957 28 131 3.30.450.20
af_I1KMQ9_125_227_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.8907 28 131 3.30.450.20
ID Description Score Start End GO Terms
AF-A0A2E0BJ74-F1-model_v4 Histidine kinase 0.9847 19 137 GO:0006355
GO:0016301
AF-A0A3S0FPH7-F1-model_v4 PAS domain S-box protein 0.9787 14 155 GO:0006355
AF-A0A7Y9P7Y2-F1-model_v4 deleted 0.9783 19 152
AF-A0A518IXJ1-F1-model_v4 Sensor protein FixL (EC 2.7.13.3) 0.9779 15 131 GO:0000155
GO:0006355
AF-A0A258BB38-F1-model_v4 Histidine kinase 0.9772 17 152 GO:0006355
GO:0016301

Feature Viewer

pLDDT pTM Quality
88.1 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map