F257284

General Info

Members Datasets Scaffolds Average Seq Length
170 132 340 156

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0326787|Ga0466969_0326787_102_626
Length 174
Sequence MTDTDLLAQLADQEKRLQFTQFDNETALALGAHLLAAARERGLPVTISVRRNGQRLFHAALPGTSADNDAWIDRKSRVVDRYGHSSFLVGTQFRAKGGSFETNSRLDPDEYAAHGGVFPVLVRGVGPVGTVGVSGLPQAEDHAFVVEQLAAFLAQPLRQKTSGRPRPDSLPSTS

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
48 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
49 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
57 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
58 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
65 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
68 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
69 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
86 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
96 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
97 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
98 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
104 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
107 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
108 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
109 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
110 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
111 2558860280 Kutzneria sp. 744 Isolate Unclassified
112 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
113 2643221553 Microbacterium sp. Root553 Isolate Unclassified
114 2643221566 Microbacterium sp. Root166 Isolate Unclassified
115 2643221597 Microbacterium sp. Root180 Isolate Unclassified
116 2643221641 Nocardioides sp. Root122 Isolate Unclassified
117 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
118 2643221711 Terrabacter sp. Root85 Isolate Unclassified
119 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
120 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
121 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
122 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
123 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
124 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
125 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
126 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
127 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
128 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
129 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
130 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
131 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
132 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.47
Metatranscriptomes 0.59
Isolates 12.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0
Rhizoplane 6.47
Rhizosphere 64.71
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0326787 3300044656 Bacteria 694
2 rootH2_10137807 3300003320 Bacteria 1451
3 rootH2_10305777 3300003320 Bacteria 1022
4 Ga0006562J51391_1015667 3300003578 Bacteria 1340
5 Ga0070658_11079476 3300005327 Bacteria 698
6 Ga0070683_100962898 3300005329 Bacteria 819
7 Ga0070668_100162388 3300005347 Bacteria 1813
8 Ga0070668_100548512 3300005347 Bacteria 1006
9 Ga0070674_100460616 3300005356 Bacteria 1051
10 Ga0070673_101209091 3300005364 Bacteria 708
11 Ga0070714_100506525 3300005435 Bacteria 1152
12 Ga0070700_100809210 3300005441 Bacteria 755
13 Ga0070678_100620815 3300005456 Bacteria 967
14 Ga0070678_100677359 3300005456 Bacteria 927
15 Ga0070681_10938142 3300005458 Bacteria 784
16 Ga0068853_100046541 3300005539 Bacteria 3720
17 Ga0070686_100347496 3300005544 Bacteria 1113
18 Ga0070665_100465798 3300005548 Bacteria 1274
19 Ga0068854_100252678 3300005578 Bacteria 1408
20 Ga0070702_100485410 3300005615 Bacteria 904
21 Ga0068852_100254121 3300005616 Bacteria 1685
22 Ga0068864_100157505 3300005618 Bacteria 2062
23 Ga0068870_10311738 3300005840 Bacteria 997
24 Ga0075363_100238844 3300006048 Bacteria 1044
25 Ga0075428_100487938 3300006844 Bacteria 1318
26 Ga0114129_10136153 3300009147 Bacteria 3370
27 Ga0105243_10030674 3300009148 Bacteria 4142
28 Ga0105248_10704955 3300009177 Bacteria 1139
29 Ga0105238_10293181 3300009551 Bacteria 1609
30 Ga0105246_10638268 3300011119 Bacteria 925
31 Ga0105246_11099871 3300011119 Bacteria 726
32 Ga0105246_11216553 3300011119 Unclassified 694
33 Ga0157375_10256551 3300013308 Bacteria 1910
34 Ga0157375_11771331 3300013308 Bacteria 732
35 Ga0157380_10022227 3300014326 Bacteria 4770
36 Ga0163161_10072916 3300017792 Bacteria 2515
37 Ga0163161_11840086 3300017792 Bacteria 539
38 Ga0207688_10064174 3300025901 Bacteria 2072
39 Ga0207688_10100811 3300025901 Bacteria 1667
40 Ga0207643_10026903 3300025908 Bacteria 3188
41 Ga0207643_10169881 3300025908 Bacteria 1315
42 Ga0207707_10507602 3300025912 Bacteria 1028
43 Ga0207649_10749756 3300025920 Bacteria 760
44 Ga0207694_10635065 3300025924 Bacteria 899
45 Ga0207659_10747171 3300025926 Bacteria 839
46 Ga0207664_10151417 3300025929 Bacteria 1971
47 Ga0207709_10217912 3300025935 Bacteria 1374
48 Ga0207669_10940848 3300025937 Bacteria 724
49 Ga0207691_11289507 3300025940 Bacteria 603
50 Ga0207711_10461992 3300025941 Bacteria 1182
51 Ga0207689_10807141 3300025942 Bacteria 792
52 Ga0207708_10894420 3300026075 Bacteria 768
53 Ga0207641_11118264 3300026088 Bacteria 787
54 Ga0207674_10815861 3300026116 Bacteria 900
55 Ga0268266_10712716 3300028379 Bacteria 967
56 Ga0307515_10000042 3300028794 Bacteria 309141
57 Ga0307515_10067108 3300028794 Bacteria 4954
58 Ga0307515_10147957 3300028794 Bacteria 2475
59 Ga0307511_10000041 3300030521 Bacteria 102249
60 Ga0307512_10179567 3300030522 Bacteria 1193
61 Ga0307509_10277422 3300031507 Bacteria 1440
62 Ga0307509_10553264 3300031507 Bacteria 828
63 Ga0307408_100504115 3300031548 Unclassified 1060
64 Ga0307508_10024610 3300031616 Bacteria 5464
65 Ga0307516_10001584 3300031730 Bacteria 31288
66 Ga0307516_10036170 3300031730 Bacteria 4944
67 Ga0307518_10000538 3300031838 Bacteria 28705
68 Ga0307410_10446524 3300031852 Unclassified 1054
69 Ga0307410_10494228 3300031852 Bacteria 1006
70 Ga0307406_10001036 3300031901 Bacteria 15502
71 Ga0307406_10341604 3300031901 Unclassified 1166
72 Ga0307406_10399417 3300031901 Bacteria 1089
73 Ga0307406_11196538 3300031901 Bacteria 660
74 Ga0307407_10393920 3300031903 Bacteria 992
75 Ga0307412_10125961 3300031911 Bacteria 1853
76 Ga0307412_10224219 3300031911 Unclassified 1443
77 Ga0307409_100138534 3300031995 Bacteria 2093
78 Ga0307416_100248693 3300032002 Bacteria 1729
79 Ga0307416_100533801 3300032002 Bacteria 1244
80 Ga0307414_10596844 3300032004 Unclassified 990
81 Ga0307414_11681648 3300032004 Bacteria 592
82 Ga0307411_10017367 3300032005 Bacteria 4098
83 Ga0307411_10395517 3300032005 Bacteria 1141
84 Ga0307411_10709315 3300032005 Unclassified 877
85 Ga0307415_100000287 3300032126 Bacteria 21838
86 Ga0307415_100305729 3300032126 Bacteria 1319
87 Ga0307507_10008231 3300033179 Bacteria 14574
88 Ga0307507_10070419 3300033179 Bacteria 3172
89 Ga0307507_10076804 3300033179 Bacteria 2976
90 Ga0373948_0170131 3300034817 Bacteria 554
91 Ga0373925_0031723 3300037068 Bacteria 3886
92 Ga0395900_0389166 3300037418 Bacteria 1361
93 Ga0395905_0633967 3300037471 Bacteria 971
94 Ga0395901_0113136 3300038443 Bacteria 2850
95 Ga0439465_0013623 3300041413 Bacteria 2533
96 Ga0451802_1311927 3300041460 Bacteria 672
97 Ga0466969_0020083 3300044656 Bacteria 3462
98 Ga0466965_0013453 3300044683 Bacteria 3861
99 Ga0466965_0033654 3300044683 Bacteria 2505
100 Ga0466965_0370372 3300044683 Bacteria 787
101 Ga0466966_0006001 3300044684 Bacteria 8019
102 Ga0466961_0089053 3300044693 Bacteria 1949
103 Ga0466961_0212796 3300044693 Bacteria 1193
104 Ga0466968_0104971 3300044735 Bacteria 1265
105 Ga0466968_0308746 3300044735 Bacteria 762
106 Ga0466970_0017482 3300044765 Bacteria 3706
107 Ga0466970_0037862 3300044765 Bacteria 2558
108 Ga0466970_0261047 3300044765 Bacteria 972
109 Ga0466957_0172642 3300044842 Bacteria 1409
110 Ga0466960_0017112 3300044901 Bacteria 3155
111 Ga0466959_0005593 3300045049 Bacteria 8638
112 Ga0451576_0128121 3300045051 Bacteria 2645
113 Ga0466967_0042473 3300045976 Bacteria 3929
114 Ga0466967_0634319 3300045976 Bacteria 1056
115 Ga0495606_0568197 3300046507 Bacteria 561
116 Ga0495622_0091393 3300046557 Unclassified 1398
117 Ga0495658_0523514 3300046683 Bacteria 759
118 Ga0496100_0372270 3300048903 Bacteria 1083
119 Ga0496101_0742636 3300048904 Bacteria 774
120 Ga0496102_0307576 3300048905 Bacteria 1494
121 Ga0496103_0204188 3300048906 Bacteria 1271
122 Ga0496104_0148885 3300048907 Bacteria 2247
123 Ga0496105_0136659 3300048908 Bacteria 2019
124 Ga0496107_0418696 3300048910 Bacteria 996
125 Ga0496112_0226689 3300048915 Bacteria 1824
126 Ga0496113_0341567 3300048916 Bacteria 1201
127 Ga0496113_0444681 3300048916 Bacteria 1041
128 Ga0496119_0000715 3300048922 Bacteria 44620
129 Ga0496122_0095605 3300048925 Bacteria 2007
130 Ga0496122_0117423 3300048925 Bacteria 1727
131 Ga0496123_0016670 3300048926 Bacteria 5951
132 Ga0496124_0367186 3300048927 Bacteria 1012
133 Ga0496125_0019171 3300048928 Bacteria 6464
134 Ga0496125_0033039 3300048928 Bacteria 4586
135 Ga0496125_0464994 3300048928 Bacteria 721
136 Ga0496126_0101051 3300048929 Bacteria 2523
137 Ga0501034_0493299 3300049571 Bacteria 1139
138 Ga0501039_0967309 3300049575 Bacteria 662
139 Ga0501070_0002896 3300049586 Bacteria 14955
140 nmdc:mga00v17_364850_c1 3300050491 Bacteria 939
141 nmdc:mga00v17_825321_c1 3300050491 Bacteria 590
142 nmdc:mga0yw44_113252_c1 3300050492 Bacteria 1740
143 nmdc:mga05p37_322624_c1 3300050507 Bacteria 1827
144 nmdc:mga09592_361510_c1 3300050508 Bacteria 1256
145 nmdc:mga0qj67_582116_c1 3300050509 Bacteria 896
146 Ga0500641_0001222 3300053096 Bacteria 9136
147 Ga0500556_0000134 3300053104 Bacteria 63361
148 Ga0500593_000018 3300053117 Bacteria 55948
149 2559432772 2558860280 Bacteria 11429938
150 2586065330 2585427649 Bacteria 9053857
151 2643783588 2643221553 Bacteria 3544260
152 2643847932 2643221566 Bacteria 3460379
153 2643994929 2643221597 Bacteria 3347721
154 2644229261 2643221641 Bacteria 4490190
155 2644454793 2643221681 Bacteria 3707866
156 2644608101 2643221711 Bacteria 4865335
157 2729906220 2728369276 Bacteria 5610032
158 2747954055 2747842429 Bacteria 3914386
159 2753072879 2751185734 Bacteria 8863695
160 2809593720 2808606522 Bacteria 9488490
161 2812322213 2811994872 Bacteria 4121241
162 2812362616 2811994880 Bacteria 4147780
163 2819664776 2818991458 Bacteria 4794049
164 2857726092 2857723135 Bacteria 4217853
165 2870727103 2870721527 Bacteria 9689237
166 2915773830 2915768154 Bacteria 8424322
167 2919444850 2919443155 Bacteria 4072969
168 2946083022 2946080515 Bacteria 4310960
169 8003315150 8003314358 Bacteria 10575343
170 8047719433 8047710418 Bacteria 11023148
171 Ga0466969_0326787
172 rootH2_10137807
173 rootH2_10305777
174 Ga0006562J51391_1015667
175 Ga0070658_11079476
176 Ga0070683_100962898
177 Ga0070668_100162388
178 Ga0070668_100548512
179 Ga0070674_100460616
180 Ga0070673_101209091
181 Ga0070714_100506525
182 Ga0070700_100809210
183 Ga0070678_100620815
184 Ga0070678_100677359
185 Ga0070681_10938142
186 Ga0068853_100046541
187 Ga0070686_100347496
188 Ga0070665_100465798
189 Ga0068854_100252678
190 Ga0070702_100485410
191 Ga0068852_100254121
192 Ga0068864_100157505
193 Ga0068870_10311738
194 Ga0075363_100238844
195 Ga0075428_100487938
196 Ga0114129_10136153
197 Ga0105243_10030674
198 Ga0105248_10704955
199 Ga0105238_10293181
200 Ga0105246_10638268
201 Ga0105246_11099871
202 Ga0105246_11216553
203 Ga0157375_10256551
204 Ga0157375_11771331
205 Ga0157380_10022227
206 Ga0163161_10072916
207 Ga0163161_11840086
208 Ga0207688_10064174
209 Ga0207688_10100811
210 Ga0207643_10026903
211 Ga0207643_10169881
212 Ga0207707_10507602
213 Ga0207649_10749756
214 Ga0207694_10635065
215 Ga0207659_10747171
216 Ga0207664_10151417
217 Ga0207709_10217912
218 Ga0207669_10940848
219 Ga0207691_11289507
220 Ga0207711_10461992
221 Ga0207689_10807141
222 Ga0207708_10894420
223 Ga0207641_11118264
224 Ga0207674_10815861
225 Ga0268266_10712716
226 Ga0307515_10000042
227 Ga0307515_10067108
228 Ga0307515_10147957
229 Ga0307511_10000041
230 Ga0307512_10179567
231 Ga0307509_10277422
232 Ga0307509_10553264
233 Ga0307408_100504115
234 Ga0307508_10024610
235 Ga0307516_10001584
236 Ga0307516_10036170
237 Ga0307518_10000538
238 Ga0307410_10446524
239 Ga0307410_10494228
240 Ga0307406_10001036
241 Ga0307406_10341604
242 Ga0307406_10399417
243 Ga0307406_11196538
244 Ga0307407_10393920
245 Ga0307412_10125961
246 Ga0307412_10224219
247 Ga0307409_100138534
248 Ga0307416_100248693
249 Ga0307416_100533801
250 Ga0307414_10596844
251 Ga0307414_11681648
252 Ga0307411_10017367
253 Ga0307411_10395517
254 Ga0307411_10709315
255 Ga0307415_100000287
256 Ga0307415_100305729
257 Ga0307507_10008231
258 Ga0307507_10070419
259 Ga0307507_10076804
260 Ga0373948_0170131
261 Ga0373925_0031723
262 Ga0395900_0389166
263 Ga0395905_0633967
264 Ga0395901_0113136
265 Ga0439465_0013623
266 Ga0451802_1311927
267 Ga0466969_0020083
268 Ga0466965_0013453
269 Ga0466965_0033654
270 Ga0466965_0370372
271 Ga0466966_0006001
272 Ga0466961_0089053
273 Ga0466961_0212796
274 Ga0466968_0104971
275 Ga0466968_0308746
276 Ga0466970_0017482
277 Ga0466970_0037862
278 Ga0466970_0261047
279 Ga0466957_0172642
280 Ga0466960_0017112
281 Ga0466959_0005593
282 Ga0451576_0128121
283 Ga0466967_0042473
284 Ga0466967_0634319
285 Ga0495606_0568197
286 Ga0495622_0091393
287 Ga0495658_0523514
288 Ga0496100_0372270
289 Ga0496101_0742636
290 Ga0496102_0307576
291 Ga0496103_0204188
292 Ga0496104_0148885
293 Ga0496105_0136659
294 Ga0496107_0418696
295 Ga0496112_0226689
296 Ga0496113_0341567
297 Ga0496113_0444681
298 Ga0496119_0000715
299 Ga0496122_0095605
300 Ga0496122_0117423
301 Ga0496123_0016670
302 Ga0496124_0367186
303 Ga0496125_0019171
304 Ga0496125_0033039
305 Ga0496125_0464994
306 Ga0496126_0101051
307 Ga0501034_0493299
308 Ga0501039_0967309
309 Ga0501070_0002896
310 nmdc:mga00v17_364850_c1
311 nmdc:mga00v17_825321_c1
312 nmdc:mga0yw44_113252_c1
313 nmdc:mga05p37_322624_c1
314 nmdc:mga09592_361510_c1
315 nmdc:mga0qj67_582116_c1
316 Ga0500641_0001222
317 Ga0500556_0000134
318 Ga0500593_000018
319 2559432772
320 2586065330
321 2643783588
322 2643847932
323 2643994929
324 2644229261
325 2644454793
326 2644608101
327 2729906220
328 2747954055
329 2753072879
330 2809593720
331 2812322213
332 2812362616
333 2819664776
334 2857726092
335 2870727103
336 2915773830
337 2919444850
338 2946083022
339 8003315150
340 8047719433

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03928

HbpS-like

Haem degrading protein HbpS-like

22

150

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4clc-assembly1.cif.gz_C-2 crystal structure of ybr137w protein 0.8914 7 158
4clc-assembly1.cif.gz_E-2 crystal structure of ybr137w protein 0.8913 7 155
4clc-assembly1.cif.gz_D-2 crystal structure of ybr137w protein 0.8911 7 154
4clc-assembly1.cif.gz_A-2 crystal structure of ybr137w protein 0.8893 7 154
4clc-assembly1.cif.gz_B-2 crystal structure of ybr137w protein 0.8698 7 154
ID Description Score Start End Superfamily
af_Q9P7D6_10_179_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9252 3 156 3.30.450.150
af_A0A1D8PRF3_3_167_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.9238 7 157 3.30.450.150
af_Q9P7D6_10_179_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8975 3 156 3.30.450.150
af_A0A1D8PRF3_3_167_3.30.450.150 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8796 7 157 3.30.450.150
4clcB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Haem-degrading domain 0.8698 7 154 3.30.450.150
ID Description Score Start End GO Terms
AF-A0A0L6HUK5-F1-model_v4 Heme-degrading domain-containing protein 0.9743 1 158
AF-A0A399NNB4-F1-model_v4 deleted 0.9721 7 157
AF-A0A4R1X6T5-F1-model_v4 deleted 0.9687 7 152
AF-A0A4P8TFQ6-F1-model_v4 Heme-degrading domain-containing protein 0.9685 7 157
AF-A0A506XLW4-F1-model_v4 Heme-degrading domain-containing protein 0.9668 3 157

Map