F257097

General Info

Members Datasets Scaffolds Average Seq Length
170 114 340 105

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101085513|Ga0307416_1010855131
Length 113
Sequence MPAASAPDIDRAVSLFHALSDPIRLSIIEMLRSGERCVCDLQGDLDAAQSKLSFHLKVLKEAGLVTDRRDGNRRIYQADPDGVAALRAQLDRFWNQALASFKELVEQDPQEGS

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
17 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
74 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
75 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
98 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
103 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
104 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
107 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
108 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.88
Nodule 0
Rhizoplane 2.35
Rhizosphere 85.29
Stem 0
Stem Tuber 0
Unclassified 7.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101085513 3300032002 Bacteria 905
2 JGI25405J52794_10117572 3300003911 Bacteria 598
3 Ga0065715_10295071 3300005293 Unclassified 1054
4 Ga0070683_100895100 3300005329 Bacteria 851
5 Ga0070683_101622023 3300005329 Bacteria 622
6 Ga0070680_101626526 3300005336 Bacteria 560
7 Ga0070669_100389007 3300005353 Bacteria 1139
8 Ga0070674_100122968 3300005356 Bacteria 1924
9 Ga0070705_101387655 3300005440 Bacteria 585
10 Ga0070662_100569214 3300005457 Bacteria 951
11 Ga0070662_101433956 3300005457 Unclassified 595
12 Ga0070681_10310314 3300005458 Bacteria 1487
13 Ga0068867_100773937 3300005459 Bacteria 854
14 Ga0070685_11250140 3300005466 Bacteria 566
15 Ga0070672_100187855 3300005543 Bacteria 1724
16 Ga0070695_101539100 3300005545 Bacteria 554
17 Ga0070664_100259789 3300005564 Bacteria 1562
18 Ga0068859_102322143 3300005617 Bacteria 591
19 Ga0068866_10205114 3300005718 Bacteria 1180
20 Ga0068866_10890240 3300005718 Bacteria 625
21 Ga0068861_100887010 3300005719 Bacteria 844
22 Ga0068870_10296758 3300005840 Bacteria 1019
23 Ga0081455_10000632 3300005937 Bacteria 45622
24 Ga0081455_10003871 3300005937 Bacteria 17049
25 Ga0081455_10006649 3300005937 Bacteria 12359
26 Ga0081455_10031957 3300005937 Bacteria 4751
27 Ga0081455_10041197 3300005937 Bacteria 4065
28 Ga0081455_10101839 3300005937 Bacteria 2304
29 Ga0081455_10825280 3300005937 Unclassified 580
30 Ga0081538_10001963 3300005981 Bacteria 20597
31 Ga0081538_10008462 3300005981 Bacteria 8724
32 Ga0075365_10715510 3300006038 Bacteria 707
33 Ga0075368_10021741 3300006042 Bacteria 2438
34 Ga0075367_10101264 3300006178 Bacteria 1761
35 Ga0075366_10986776 3300006195 Unclassified 525
36 Ga0075428_100003519 3300006844 Bacteria 17163
37 Ga0075428_102646684 3300006844 Bacteria 512
38 Ga0075430_100001382 3300006846 Bacteria 19703
39 Ga0075430_100095392 3300006846 Bacteria 2486
40 Ga0075430_101593735 3300006846 Bacteria 536
41 Ga0075431_100000193 3300006847 Bacteria 44515
42 Ga0075431_100152877 3300006847 Bacteria 2376
43 Ga0075431_101954091 3300006847 Bacteria 542
44 Ga0075433_10925072 3300006852 Bacteria 760
45 Ga0068865_100068552 3300006881 Bacteria 2508
46 Ga0097620_102322365 3300006931 Bacteria 591
47 Ga0105250_10485281 3300009092 Bacteria 559
48 Ga0111539_10004003 3300009094 Bacteria 19351
49 Ga0111539_10369999 3300009094 Bacteria 1668
50 Ga0111539_10463513 3300009094 Bacteria 1475
51 Ga0111539_11501744 3300009094 Bacteria 781
52 Ga0114129_10007353 3300009147 Bacteria 15676
53 Ga0114129_10205131 3300009147 Bacteria 2668
54 Ga0114129_12295741 3300009147 Bacteria 648
55 Ga0105243_10302972 3300009148 Bacteria 1449
56 Ga0105243_12471060 3300009148 Bacteria 558
57 Ga0105242_10536311 3300009176 Bacteria 1119
58 Ga0105238_11416426 3300009551 Bacteria 722
59 Ga0105238_11647366 3300009551 Bacteria 672
60 Ga0105249_10322912 3300009553 Bacteria 1555
61 Ga0105033_100612 3300009986 Bacteria 2770
62 Ga0157373_10152132 3300013100 Bacteria 1627
63 Ga0157380_10049214 3300014326 Bacteria 3323
64 Ga0163161_10236222 3300017792 Unclassified 1420
65 Ga0206356_10669501 3300020070 Bacteria 1045
66 Ga0206354_10577657 3300020081 Bacteria 1035
67 Ga0213873_10009006 3300021358 Bacteria 2058
68 Ga0213874_10000341 3300021377 Bacteria 9213
69 Ga0213876_10027630 3300021384 Bacteria 2993
70 Ga0213876_10107218 3300021384 Bacteria 1482
71 Ga0207642_10232031 3300025899 Bacteria 1037
72 Ga0207693_10842106 3300025915 Bacteria 706
73 Ga0207652_11486005 3300025921 Bacteria 581
74 Ga0207652_11693770 3300025921 Bacteria 537
75 Ga0207646_11348648 3300025922 Unclassified 622
76 Ga0207681_10433306 3300025923 Bacteria 1067
77 Ga0207694_10963876 3300025924 Bacteria 722
78 Ga0207706_10908153 3300025933 Unclassified 743
79 Ga0207709_10266575 3300025935 Bacteria 1258
80 Ga0207704_10230601 3300025938 Bacteria 1377
81 Ga0207691_10202741 3300025940 Bacteria 1726
82 Ga0207661_11122874 3300025944 Bacteria 724
83 Ga0207679_11595199 3300025945 Bacteria 598
84 Ga0207640_10117608 3300025981 Bacteria 1897
85 Ga0207677_10888344 3300026023 Bacteria 803
86 Ga0207639_10342805 3300026041 Bacteria 1332
87 Ga0207639_11895990 3300026041 Bacteria 557
88 Ga0207708_10091377 3300026075 Bacteria 2347
89 Ga0207648_10135071 3300026089 Bacteria 2173
90 Ga0207648_10586474 3300026089 Bacteria 1026
91 Ga0207675_100552743 3300026118 Bacteria 1150
92 Ga0207675_100572698 3300026118 Bacteria 1130
93 Ga0207683_10347996 3300026121 Bacteria 1360
94 Ga0209813_10011544 3300027866 Bacteria 2312
95 Ga0207428_10002110 3300027907 Bacteria 20036
96 Ga0207428_10569071 3300027907 Bacteria 818
97 Ga0265325_10448443 3300031241 Bacteria 562
98 Ga0265331_10034989 3300031250 Bacteria 2474
99 Ga0265327_10067490 3300031251 Bacteria 1801
100 Ga0307408_100244355 3300031548 Bacteria 1477
101 Ga0307408_101947777 3300031548 Unclassified 564
102 Ga0265314_10028872 3300031711 Bacteria 4128
103 Ga0265342_10599830 3300031712 Bacteria 556
104 Ga0307413_11409181 3300031824 Unclassified 613
105 Ga0307413_11781426 3300031824 Bacteria 551
106 Ga0307410_10133529 3300031852 Bacteria 1826
107 Ga0307406_10023704 3300031901 Bacteria 3655
108 Ga0307406_10886780 3300031901 Bacteria 758
109 Ga0307407_10224357 3300031903 Bacteria 1272
110 Ga0307409_100294303 3300031995 Bacteria 1507
111 Ga0307409_100364443 3300031995 Bacteria 1368
112 Ga0307409_100561405 3300031995 Bacteria 1122
113 Ga0307409_100604087 3300031995 Bacteria 1084
114 Ga0307409_102715043 3300031995 Bacteria 523
115 Ga0307416_100059100 3300032002 Bacteria 3113
116 Ga0307416_100690460 3300032002 Bacteria 1109
117 Ga0307416_101142095 3300032002 Bacteria 884
118 Ga0307414_10064646 3300032004 Bacteria 2606
119 Ga0307411_12090535 3300032005 Unclassified 530
120 Ga0307415_100107030 3300032126 Bacteria 2065
121 Ga0307415_100763043 3300032126 Bacteria 879
122 Ga0307415_101174459 3300032126 Bacteria 722
123 Ga0373935_0237202 3300035692 Bacteria 1272
124 Ga0436364_0071553 3300037853 Bacteria 9903
125 Ga0436364_0607013 3300037853 Bacteria 3366
126 Ga0395901_0973946 3300038443 Bacteria 826
127 Ga0436365_0386880 3300039437 Bacteria 4849
128 Ga0436365_0514012 3300039437 Bacteria 2764
129 Ga0436365_1457260 3300039437 Bacteria 5157
130 Ga0436365_1733962 3300039437 Bacteria 887
131 Ga0436363_0016147 3300039450 Bacteria 23431
132 Ga0436362_0131855 3300039453 Bacteria 836
133 Ga0436362_0407009 3300039453 Bacteria 1044
134 Ga0466965_0530526 3300044683 Bacteria 663
135 Ga0466963_0184620 3300044694 Bacteria 1456
136 Ga0466971_0101748 3300044719 Bacteria 1321
137 Ga0466968_0020569 3300044735 Bacteria 2666
138 Ga0466970_0410948 3300044765 Bacteria 773
139 Ga0466958_0383170 3300045836 Bacteria 907
140 Ga0466967_0137805 3300045976 Bacteria 2270
141 Ga0466967_0210924 3300045976 Bacteria 1842
142 Ga0466967_0244356 3300045976 Bacteria 1713
143 Ga0466967_0694595 3300045976 Bacteria 1007
144 Ga0466967_1383457 3300045976 Bacteria 701
145 Ga0466967_1396069 3300045976 Bacteria 697
146 Ga0496110_0568546 3300048913 Bacteria 1030
147 Ga0496111_0455378 3300048914 Bacteria 944
148 Ga0496111_0973668 3300048914 Bacteria 609
149 Ga0496112_0035591 3300048915 Bacteria 4852
150 Ga0496126_0046155 3300048929 Bacteria 3999
151 Ga0501039_1072398 3300049575 Bacteria 625
152 Ga0501076_1152791 3300049592 Bacteria 638
153 Ga0501077_0452849 3300049593 Archaea 822
154 Ga0501263_072215 3300049760 Unclassified 558
155 nmdc:mga03n38_948480_c1 3300050490 Unclassified 508
156 nmdc:mga0yw44_594135_c1 3300050492 Bacteria 752
157 nmdc:mga0k408_865653_c1 3300050493 Unclassified 525
158 nmdc:mga06z11_19145_c1 3300050494 Bacteria 3142
159 nmdc:mga04h51_91371_c1 3300050495 Bacteria 1096
160 nmdc:mga05p37_184_c1 3300050507 Bacteria 61426
161 nmdc:mga09592_3640_c1 3300050508 Bacteria 12426
162 nmdc:mga0qj67_113991_c1 3300050509 Bacteria 2183
163 nmdc:mga0qj67_4384_c1 3300050509 Bacteria 10220
164 nmdc:mga06r32_1501_c1 3300050510 Bacteria 20962
165 nmdc:mga06r32_1658928_c1 3300050510 Bacteria 577
166 nmdc:mga06r32_56630_c1 3300050510 Bacteria 3764
167 nmdc:mga08y16_1248691_c1 3300050511 Bacteria 712
168 nmdc:mga08y16_414108_c1 3300050511 Bacteria 1378
169 nmdc:mga08y16_5543_c1 3300050511 Bacteria 13216
170 Ga0466962_0274717 3300061719 Bacteria 831
171 Ga0307416_101085513
172 JGI25405J52794_10117572
173 Ga0065715_10295071
174 Ga0070683_100895100
175 Ga0070683_101622023
176 Ga0070680_101626526
177 Ga0070669_100389007
178 Ga0070674_100122968
179 Ga0070705_101387655
180 Ga0070662_100569214
181 Ga0070662_101433956
182 Ga0070681_10310314
183 Ga0068867_100773937
184 Ga0070685_11250140
185 Ga0070672_100187855
186 Ga0070695_101539100
187 Ga0070664_100259789
188 Ga0068859_102322143
189 Ga0068866_10205114
190 Ga0068866_10890240
191 Ga0068861_100887010
192 Ga0068870_10296758
193 Ga0081455_10000632
194 Ga0081455_10003871
195 Ga0081455_10006649
196 Ga0081455_10031957
197 Ga0081455_10041197
198 Ga0081455_10101839
199 Ga0081455_10825280
200 Ga0081538_10001963
201 Ga0081538_10008462
202 Ga0075365_10715510
203 Ga0075368_10021741
204 Ga0075367_10101264
205 Ga0075366_10986776
206 Ga0075428_100003519
207 Ga0075428_102646684
208 Ga0075430_100001382
209 Ga0075430_100095392
210 Ga0075430_101593735
211 Ga0075431_100000193
212 Ga0075431_100152877
213 Ga0075431_101954091
214 Ga0075433_10925072
215 Ga0068865_100068552
216 Ga0097620_102322365
217 Ga0105250_10485281
218 Ga0111539_10004003
219 Ga0111539_10369999
220 Ga0111539_10463513
221 Ga0111539_11501744
222 Ga0114129_10007353
223 Ga0114129_10205131
224 Ga0114129_12295741
225 Ga0105243_10302972
226 Ga0105243_12471060
227 Ga0105242_10536311
228 Ga0105238_11416426
229 Ga0105238_11647366
230 Ga0105249_10322912
231 Ga0105033_100612
232 Ga0157373_10152132
233 Ga0157380_10049214
234 Ga0163161_10236222
235 Ga0206356_10669501
236 Ga0206354_10577657
237 Ga0213873_10009006
238 Ga0213874_10000341
239 Ga0213876_10027630
240 Ga0213876_10107218
241 Ga0207642_10232031
242 Ga0207693_10842106
243 Ga0207652_11486005
244 Ga0207652_11693770
245 Ga0207646_11348648
246 Ga0207681_10433306
247 Ga0207694_10963876
248 Ga0207706_10908153
249 Ga0207709_10266575
250 Ga0207704_10230601
251 Ga0207691_10202741
252 Ga0207661_11122874
253 Ga0207679_11595199
254 Ga0207640_10117608
255 Ga0207677_10888344
256 Ga0207639_10342805
257 Ga0207639_11895990
258 Ga0207708_10091377
259 Ga0207648_10135071
260 Ga0207648_10586474
261 Ga0207675_100552743
262 Ga0207675_100572698
263 Ga0207683_10347996
264 Ga0209813_10011544
265 Ga0207428_10002110
266 Ga0207428_10569071
267 Ga0265325_10448443
268 Ga0265331_10034989
269 Ga0265327_10067490
270 Ga0307408_100244355
271 Ga0307408_101947777
272 Ga0265314_10028872
273 Ga0265342_10599830
274 Ga0307413_11409181
275 Ga0307413_11781426
276 Ga0307410_10133529
277 Ga0307406_10023704
278 Ga0307406_10886780
279 Ga0307407_10224357
280 Ga0307409_100294303
281 Ga0307409_100364443
282 Ga0307409_100561405
283 Ga0307409_100604087
284 Ga0307409_102715043
285 Ga0307416_100059100
286 Ga0307416_100690460
287 Ga0307416_101142095
288 Ga0307414_10064646
289 Ga0307411_12090535
290 Ga0307415_100107030
291 Ga0307415_100763043
292 Ga0307415_101174459
293 Ga0373935_0237202
294 Ga0436364_0071553
295 Ga0436364_0607013
296 Ga0395901_0973946
297 Ga0436365_0386880
298 Ga0436365_0514012
299 Ga0436365_1457260
300 Ga0436365_1733962
301 Ga0436363_0016147
302 Ga0436362_0131855
303 Ga0436362_0407009
304 Ga0466965_0530526
305 Ga0466963_0184620
306 Ga0466971_0101748
307 Ga0466968_0020569
308 Ga0466970_0410948
309 Ga0466958_0383170
310 Ga0466967_0137805
311 Ga0466967_0210924
312 Ga0466967_0244356
313 Ga0466967_0694595
314 Ga0466967_1383457
315 Ga0466967_1396069
316 Ga0496110_0568546
317 Ga0496111_0455378
318 Ga0496111_0973668
319 Ga0496112_0035591
320 Ga0496126_0046155
321 Ga0501039_1072398
322 Ga0501076_1152791
323 Ga0501077_0452849
324 Ga0501263_072215
325 nmdc:mga03n38_948480_c1
326 nmdc:mga0yw44_594135_c1
327 nmdc:mga0k408_865653_c1
328 nmdc:mga06z11_19145_c1
329 nmdc:mga04h51_91371_c1
330 nmdc:mga05p37_184_c1
331 nmdc:mga09592_3640_c1
332 nmdc:mga0qj67_113991_c1
333 nmdc:mga0qj67_4384_c1
334 nmdc:mga06r32_1501_c1
335 nmdc:mga06r32_1658928_c1
336 nmdc:mga06r32_56630_c1
337 nmdc:mga08y16_1248691_c1
338 nmdc:mga08y16_414108_c1
339 nmdc:mga08y16_5543_c1
340 Ga0466962_0274717

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

21

67

0.98

PF12840

HTH_20

Helix-turn-helix domain

19

68

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9302 2 82
4lb5-assembly1.cif.gz_B crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9202 26 70
2quf-assembly1.cif.gz_A crystal structure of transcription factor axxa-pf0095 from pyrococcus furiosus 0.9182 8 71
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.9156 29 71
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9132 2 82
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9637 13 69 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9628 11 75 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9521 9 70 1.10.10.10
af_O53478_1_106_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9336 4 98 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9289 10 71 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5B9D6D5-F1-model_v4 DNA-binding transcriptional repressor ArsR 0.9762 2 73 GO:0003677
GO:0003700
AF-A0A7X5UP31-F1-model_v4 DNA-binding transcriptional ArsR family regulator 0.9642 1 99 GO:0003677
GO:0003700
AF-H5XIG7-F1-model_v4 Putative transcriptional regulator 0.9614 4 98 GO:0003700
AF-A0A7X8D0U1-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9604 4 85 GO:0003700
AF-A0A2D8IVG3-F1-model_v4 ArsR family transcriptional regulator 0.958 3 85 GO:0003700

Map