F256867

General Info

Members Datasets Scaffolds Average Seq Length
170 142 340 327

Family's Representative Sequence

Representative Sequence 3300025298|Ga0209050_1005599|Ga0209050_10055992
Length 322
Sequence MQKRRLGNLEVSAIGLGCMGLSHAYGPAVEKSAGIAFLRAAVERGVTLFDTAEIYGPFTNEELVGEALAPVRDQVALATKFGFSPDPKTGKSAGLNSRPAHIREVVEASLKRLRTDRIDLLYQHRVDPAVPIEDVAGAVKDLIAAGKVKHFGLSEAGEKTIRRAHAVQPVTALQSEYSLWWREPEDSVFPVLQELGIGFVPFSPLGRGFLVGSVDANTAFTEGDFRNTLPRFSAESRKANQGIADTVAALAKAKQVTPAQIALAWILARKPWIVPIPGTTKLHRLEENIAAASVALSAADAVAAIPVHGDRYAEAAQRQIDR

Samples

Sample ID Description Type Environment
1 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
84 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
85 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
127 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
133 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
134 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
135 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
136 2738543024 Aminobacter sp. AP02 Isolate Unclassified
137 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
138 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
139 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
140 8005395548 Rhizobium sp. R339 Isolate Nodule
141 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
142 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.35
Nodule 3.53
Rhizoplane 0.59
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209050_1005599 3300025298 Bacteria 7798
2 JGI25153J46596_10000048 3300003215 Bacteria 141500
3 rootH1_10007530 3300003323 Bacteria 2011
4 Ga0055524_1039036 3300003775 Bacteria 1232
5 Ga0055531_10010883 3300003794 Bacteria 4465
6 Ga0070676_10004064 3300005328 Bacteria 7688
7 Ga0070683_100485317 3300005329 Bacteria 1180
8 Ga0070670_100010525 3300005331 Bacteria 7897
9 Ga0068869_100063172 3300005334 Bacteria 2719
10 Ga0068868_100042513 3300005338 Bacteria 3547
11 Ga0070674_100112559 3300005356 Bacteria 2001
12 Ga0070673_100029734 3300005364 Bacteria 4077
13 Ga0070667_100435364 3300005367 Bacteria 1197
14 Ga0070709_10318032 3300005434 Bacteria 1141
15 Ga0070714_100133861 3300005435 Bacteria 2217
16 Ga0070713_100021369 3300005436 Bacteria 4976
17 Ga0070710_10142628 3300005437 Bacteria 1470
18 Ga0070708_100007264 3300005445 Bacteria 8856
19 Ga0070685_10010294 3300005466 Bacteria 4855
20 Ga0070706_100033699 3300005467 Bacteria 4728
21 Ga0070707_100015721 3300005468 Bacteria 7105
22 Ga0070707_100029087 3300005468 Bacteria 5260
23 Ga0070698_100011394 3300005471 Bacteria 9435
24 Ga0070698_100027804 3300005471 Bacteria 5877
25 Ga0070698_100069847 3300005471 Bacteria 3525
26 Ga0070698_100218700 3300005471 Bacteria 1839
27 Ga0070699_100021400 3300005518 Bacteria 5578
28 Ga0070697_100017787 3300005536 Bacteria 5597
29 Ga0070665_100001567 3300005548 Bacteria 26375
30 Ga0070665_100060294 3300005548 Bacteria 3803
31 Ga0068854_100044837 3300005578 Bacteria 3141
32 Ga0068856_100343156 3300005614 Bacteria 1512
33 Ga0068859_100047273 3300005617 Bacteria 4323
34 Ga0068859_100063739 3300005617 Bacteria 3717
35 Ga0068859_100404492 3300005617 Bacteria 1461
36 Ga0081540_1072150 3300005983 Bacteria 1592
37 Ga0075365_10158063 3300006038 Bacteria 1578
38 Ga0075368_10008489 3300006042 Bacteria 3661
39 Ga0070712_100120462 3300006175 Bacteria 1973
40 Ga0075367_10002026 3300006178 Bacteria 9056
41 Ga0075367_10071977 3300006178 Bacteria 2080
42 Ga0075369_10015956 3300006186 Bacteria 3024
43 Ga0097621_100082128 3300006237 Bacteria 2683
44 Ga0075431_100008761 3300006847 Bacteria 10136
45 Ga0075434_100397840 3300006871 Bacteria 1398
46 Ga0097620_100047268 3300006931 Bacteria 4323
47 Ga0097620_100063740 3300006931 Bacteria 3717
48 Ga0097620_100404468 3300006931 Bacteria 1461
49 Ga0105251_10000054 3300009011 Bacteria 105910
50 Ga0105245_10005020 3300009098 Bacteria 11635
51 Ga0105245_10050707 3300009098 Bacteria 3720
52 Ga0105241_10000001 3300009174 Bacteria 879793
53 Ga0105241_10270196 3300009174 Bacteria 1448
54 Ga0105242_10056253 3300009176 Bacteria 3219
55 Ga0105248_10021161 3300009177 Bacteria 7206
56 Ga0105248_10545017 3300009177 Bacteria 1309
57 Ga0105237_10174169 3300009545 Bacteria 2152
58 Ga0105238_10018363 3300009551 Bacteria 7117
59 Ga0105238_10156881 3300009551 Bacteria 2251
60 Ga0157373_10002961 3300013100 Bacteria 12868
61 Ga0157370_10202204 3300013104 Bacteria 1843
62 Ga0157374_10072746 3300013296 Bacteria 3244
63 Ga0157374_10476510 3300013296 Bacteria 1251
64 Ga0163162_10034979 3300013306 Bacteria 5002
65 Ga0157375_10025099 3300013308 Bacteria 5529
66 Ga0157375_10086678 3300013308 Bacteria 3183
67 Ga0157375_10123598 3300013308 Bacteria 2700
68 Ga0163163_10146621 3300014325 Bacteria 2404
69 Ga0157380_10084700 3300014326 Unclassified 2600
70 Ga0157377_10018730 3300014745 Bacteria 3604
71 Ga0157379_10135024 3300014968 Bacteria 2222
72 Ga0163161_10005489 3300017792 Bacteria 8793
73 Ga0213872_10015974 3300021361 Bacteria 3487
74 Ga0209673_1005448 3300025273 Bacteria 6388
75 Ga0209564_1004779 3300025295 Bacteria 8082
76 Ga0209256_1003903 3300025299 Bacteria 9861
77 Ga0209051_1057695 3300025303 Bacteria 1242
78 Ga0209257_1000237 3300025304 Bacteria 128812
79 Ga0207713_1000018 3300025735 Bacteria 362635
80 Ga0207692_10120718 3300025898 Bacteria 1467
81 Ga0207645_10010286 3300025907 Bacteria 6426
82 Ga0207645_10243368 3300025907 Bacteria 1189
83 Ga0207684_10000932 3300025910 Bacteria 33029
84 Ga0207684_10126837 3300025910 Bacteria 2190
85 Ga0207654_10000004 3300025911 Bacteria 902334
86 Ga0207707_10066492 3300025912 Bacteria 3140
87 Ga0207671_10108048 3300025914 Bacteria 2114
88 Ga0207693_10047469 3300025915 Bacteria 3374
89 Ga0207646_10010343 3300025922 Bacteria 9126
90 Ga0207646_10060084 3300025922 Bacteria 3395
91 Ga0207687_10020633 3300025927 Bacteria 4372
92 Ga0207687_10180365 3300025927 Bacteria 1636
93 Ga0207664_10066169 3300025929 Bacteria 2896
94 Ga0207706_10016444 3300025933 Bacteria 6679
95 Ga0207709_10038923 3300025935 Bacteria 2836
96 Ga0207711_10016219 3300025941 Bacteria 6186
97 Ga0207711_10151492 3300025941 Bacteria 2093
98 Ga0207711_10232775 3300025941 Bacteria 1688
99 Ga0207689_10137569 3300025942 Bacteria 2011
100 Ga0207651_10097209 3300025960 Bacteria 2174
101 Ga0207651_10305160 3300025960 Bacteria 1325
102 Ga0207640_10124331 3300025981 Bacteria 1855
103 Ga0207658_10325817 3300025986 Bacteria 1331
104 Ga0207677_10025075 3300026023 Bacteria 3715
105 Ga0207677_10136785 3300026023 Bacteria 1869
106 Ga0207702_10083213 3300026078 Bacteria 2784
107 Ga0207676_10056055 3300026095 Bacteria 3097
108 Ga0209281_1000003 3300027111 Bacteria 1260089
109 Ga0209813_10019301 3300027866 Bacteria 1893
110 Ga0209974_10033254 3300027876 Bacteria 1711
111 Ga0268266_10000593 3300028379 Bacteria 49658
112 Ga0265338_10001634 3300028800 Bacteria 35869
113 Ga0265325_10039058 3300031241 Bacteria 2501
114 Ga0265316_10071224 3300031344 Bacteria 2680
115 Ga0307513_10054097 3300031456 Bacteria 4307
116 Ga0307509_10003502 3300031507 Bacteria 23683
117 Ga0307408_100103862 3300031548 Bacteria 2170
118 Ga0265342_10076541 3300031712 Bacteria 1939
119 Ga0307405_10187773 3300031731 Bacteria 1490
120 Ga0307410_10009755 3300031852 Bacteria 5403
121 Ga0307410_10144537 3300031852 Bacteria 1764
122 Ga0307409_100022159 3300031995 Bacteria 4373
123 Ga0307416_100451438 3300032002 Bacteria 1338
124 Ga0307416_100497782 3300032002 Bacteria 1282
125 Ga0307414_10349192 3300032004 Bacteria 1269
126 Ga0373961_0003019 3300035241 Bacteria 4246
127 Ga0373927_0041553 3300035695 Bacteria 2982
128 Ga0373937_0072794 3300036401 Bacteria 3170
129 Ga0395905_0330433 3300037471 Bacteria 1415
130 Ga0436361_0485891 3300039447 Bacteria 3018
131 Ga0439466_0024502 3300041411 Bacteria 2114
132 Ga0453683_0038795 3300044673 Bacteria 2995
133 Ga0451576_0092522 3300045051 Bacteria 3145
134 Ga0495653_0141480 3300046463 Bacteria 1692
135 Ga0495580_0214632 3300046472 Bacteria 1323
136 Ga0495607_0000101 3300046501 Bacteria 91495
137 Ga0495608_0032081 3300046511 Bacteria 3551
138 Ga0495630_0303597 3300046517 Bacteria 1220
139 Ga0495633_0000299 3300046558 Bacteria 56377
140 Ga0495635_0034647 3300046663 Bacteria 3502
141 Ga0495657_0032010 3300046675 Bacteria 3673
142 Ga0495669_0113873 3300046684 Bacteria 1264
143 Ga0495660_0115744 3300046810 Bacteria 1363
144 Ga0495680_0188947 3300047322 Bacteria 1483
145 Ga0495684_0019663 3300047471 Bacteria 5203
146 Ga0495686_0022628 3300047472 Bacteria 4158
147 Ga0496114_0000035 3300048917 Bacteria 160029
148 Ga0496124_0082067 3300048927 Bacteria 2647
149 Ga0501070_0041968 3300049586 Bacteria 3809
150 Ga0501072_0003339 3300049588 Bacteria 12071
151 Ga0501080_0308049 3300049742 Bacteria 1435
152 Ga0501083_0000558 3300049744 Bacteria 23877
153 nmdc:mga03n38_76689_c1 3300050490 Bacteria 1560
154 nmdc:mga0yw44_17303_c1 3300050492 Bacteria 3279
155 nmdc:mga06r32_3100_c1 3300050510 Bacteria 14888
156 nmdc:mga06r32_57985_c1 3300050510 Bacteria 3721
157 nmdc:mga0sz30_17252_c1 3300050516 Bacteria 2877
158 Ga0495595_0046296 3300053084 Bacteria 2003
159 Ga0495619_0117902 3300053085 Bacteria 1818
160 Ga0500651_0000148 3300053093 Bacteria 44606
161 Ga0500597_107379 3300053120 Bacteria 1212
162 Ga0500624_000288 3300053157 Bacteria 17424
163 Ga0530510_0040809 3300061734 Bacteria 3350
164 2739305814 2738543024 Bacteria 5603683
165 2842205964 2842205361 Bacteria 6340321
166 2842279421 2842278818 Bacteria 6340002
167 2842398757 2842395702 Bacteria 6780583
168 8005399208 8005395548 Bacteria 6806915
169 8005699939 8005695170 Bacteria 6912330
170 8057581627 8057575449 Bacteria 7367519
171 Ga0209050_1005599
172 JGI25153J46596_10000048
173 rootH1_10007530
174 Ga0055524_1039036
175 Ga0055531_10010883
176 Ga0070676_10004064
177 Ga0070683_100485317
178 Ga0070670_100010525
179 Ga0068869_100063172
180 Ga0068868_100042513
181 Ga0070674_100112559
182 Ga0070673_100029734
183 Ga0070667_100435364
184 Ga0070709_10318032
185 Ga0070714_100133861
186 Ga0070713_100021369
187 Ga0070710_10142628
188 Ga0070708_100007264
189 Ga0070685_10010294
190 Ga0070706_100033699
191 Ga0070707_100015721
192 Ga0070707_100029087
193 Ga0070698_100011394
194 Ga0070698_100027804
195 Ga0070698_100069847
196 Ga0070698_100218700
197 Ga0070699_100021400
198 Ga0070697_100017787
199 Ga0070665_100001567
200 Ga0070665_100060294
201 Ga0068854_100044837
202 Ga0068856_100343156
203 Ga0068859_100047273
204 Ga0068859_100063739
205 Ga0068859_100404492
206 Ga0081540_1072150
207 Ga0075365_10158063
208 Ga0075368_10008489
209 Ga0070712_100120462
210 Ga0075367_10002026
211 Ga0075367_10071977
212 Ga0075369_10015956
213 Ga0097621_100082128
214 Ga0075431_100008761
215 Ga0075434_100397840
216 Ga0097620_100047268
217 Ga0097620_100063740
218 Ga0097620_100404468
219 Ga0105251_10000054
220 Ga0105245_10005020
221 Ga0105245_10050707
222 Ga0105241_10000001
223 Ga0105241_10270196
224 Ga0105242_10056253
225 Ga0105248_10021161
226 Ga0105248_10545017
227 Ga0105237_10174169
228 Ga0105238_10018363
229 Ga0105238_10156881
230 Ga0157373_10002961
231 Ga0157370_10202204
232 Ga0157374_10072746
233 Ga0157374_10476510
234 Ga0163162_10034979
235 Ga0157375_10025099
236 Ga0157375_10086678
237 Ga0157375_10123598
238 Ga0163163_10146621
239 Ga0157380_10084700
240 Ga0157377_10018730
241 Ga0157379_10135024
242 Ga0163161_10005489
243 Ga0213872_10015974
244 Ga0209673_1005448
245 Ga0209564_1004779
246 Ga0209256_1003903
247 Ga0209051_1057695
248 Ga0209257_1000237
249 Ga0207713_1000018
250 Ga0207692_10120718
251 Ga0207645_10010286
252 Ga0207645_10243368
253 Ga0207684_10000932
254 Ga0207684_10126837
255 Ga0207654_10000004
256 Ga0207707_10066492
257 Ga0207671_10108048
258 Ga0207693_10047469
259 Ga0207646_10010343
260 Ga0207646_10060084
261 Ga0207687_10020633
262 Ga0207687_10180365
263 Ga0207664_10066169
264 Ga0207706_10016444
265 Ga0207709_10038923
266 Ga0207711_10016219
267 Ga0207711_10151492
268 Ga0207711_10232775
269 Ga0207689_10137569
270 Ga0207651_10097209
271 Ga0207651_10305160
272 Ga0207640_10124331
273 Ga0207658_10325817
274 Ga0207677_10025075
275 Ga0207677_10136785
276 Ga0207702_10083213
277 Ga0207676_10056055
278 Ga0209281_1000003
279 Ga0209813_10019301
280 Ga0209974_10033254
281 Ga0268266_10000593
282 Ga0265338_10001634
283 Ga0265325_10039058
284 Ga0265316_10071224
285 Ga0307513_10054097
286 Ga0307509_10003502
287 Ga0307408_100103862
288 Ga0265342_10076541
289 Ga0307405_10187773
290 Ga0307410_10009755
291 Ga0307410_10144537
292 Ga0307409_100022159
293 Ga0307416_100451438
294 Ga0307416_100497782
295 Ga0307414_10349192
296 Ga0373961_0003019
297 Ga0373927_0041553
298 Ga0373937_0072794
299 Ga0395905_0330433
300 Ga0436361_0485891
301 Ga0439466_0024502
302 Ga0453683_0038795
303 Ga0451576_0092522
304 Ga0495653_0141480
305 Ga0495580_0214632
306 Ga0495607_0000101
307 Ga0495608_0032081
308 Ga0495630_0303597
309 Ga0495633_0000299
310 Ga0495635_0034647
311 Ga0495657_0032010
312 Ga0495669_0113873
313 Ga0495660_0115744
314 Ga0495680_0188947
315 Ga0495684_0019663
316 Ga0495686_0022628
317 Ga0496114_0000035
318 Ga0496124_0082067
319 Ga0501070_0041968
320 Ga0501072_0003339
321 Ga0501080_0308049
322 Ga0501083_0000558
323 nmdc:mga03n38_76689_c1
324 nmdc:mga0yw44_17303_c1
325 nmdc:mga06r32_3100_c1
326 nmdc:mga06r32_57985_c1
327 nmdc:mga0sz30_17252_c1
328 Ga0495595_0046296
329 Ga0495619_0117902
330 Ga0500651_0000148
331 Ga0500597_107379
332 Ga0500624_000288
333 Ga0530510_0040809
334 2739305814
335 2842205964
336 2842279421
337 2842398757
338 8005399208
339 8005699939
340 8057581627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

13

305

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9296 1 310
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9259 1 318
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.923 2 312
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9189 3 306
1pz0-assembly1.cif.gz_A structure of nadph-dependent family 11 aldo-keto reductase akr11a(holo) 0.9174 2 312
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9621 1 322 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9433 4 328 3.20.20.100
af_A0A1D6KUU8_358_629_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9429 74 327 3.20.20.100
af_P49249_9_269_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9387 2 257 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9295 1 223 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A328TDJ7-F1-model_v4 Aldo/keto reductase family protein 0.9947 124 207 GO:0004033
GO:0005737
AF-A0A834TAT5-F1-model_v4 Putative aldo-keto reductase 1 0.9886 113 193 GO:0004033
GO:0005737
AF-W9VHQ2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9878 98 199 GO:0004033
GO:0005737
AF-A0A2V9HFB4-F1-model_v4 Aldo/keto reductase 0.9874 1 327 GO:0004033
GO:0005737
AF-A0A2V5YE55-F1-model_v4 Aldo/keto reductase 0.9862 1 330 GO:0004033
GO:0005737

Map