F256367

General Info

Members Datasets Scaffolds Average Seq Length
170 143 163 89

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100242351|Ga0070686_1002423512
Length 98
Sequence MGFLSRNPSVKIAREAEIINKLGLHARPCAKFVKLANSFRSDVWVCKDSDTVNGKSIMGLMMLAAGLGSRLMLTCEGPDAEKALEALEKLILSKFDED

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132512 Azospira oryzae 6a3 Isolate Unclassified
3 2721755523 Delftia sp. HK171 Isolate Unclassified
4 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
5 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
6 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
17 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
48 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
49 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
50 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
84 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
85 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
94 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
95 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
96 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
97 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
98 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
99 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
102 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
103 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
104 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
130 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
131 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
141 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
142 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
143 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.88
Metatranscriptomes 0
Isolates 4.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.35
Nodule 2.35
Rhizoplane 3.53
Rhizosphere 60.59
Stem 0
Stem Tuber 0
Unclassified 11.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000040 3300002705 Bacteria 106617
2 JGI25154J39366_1000060 3300002738 Bacteria 106617
3 JGI25157J39369_1000058 3300002741 Bacteria 106617
4 JGI25150J39212_1030202 3300002774 Bacteria 755
5 JGI25159J45721_1000140 3300002987 Bacteria 33403
6 JGI25160J50197_1000198 3300003354 Bacteria 50243
7 JGI25161J50226_1000021 3300003374 Bacteria 163584
8 Ga0055537_1008598 3300003773 Bacteria 2338
9 Ga0055536_1079976 3300003781 Bacteria 622
10 Ga0055534_1001448 3300003784 Bacteria 9436
11 Ga0055534_1026194 3300003784 Bacteria 930
12 Ga0055530_10046641 3300003791 Bacteria 1028
13 Ga0055543_1000238 3300004625 Bacteria 42822
14 Ga0065704_10081947 3300005289 Bacteria 3677
15 Ga0070680_101002784 3300005336 Bacteria 721
16 Ga0070692_10327559 3300005345 Bacteria 944
17 Ga0070705_101728868 3300005440 Bacteria 529
18 Ga0070700_100002610 3300005441 Bacteria 9209
19 Ga0068867_100185820 3300005459 Bacteria 1655
20 Ga0070685_11231617 3300005466 Bacteria 570
21 Ga0068853_100000060 3300005539 Bacteria 78205
22 Ga0070672_100264511 3300005543 Bacteria 1451
23 Ga0070672_100838953 3300005543 Bacteria 810
24 Ga0070686_100242351 3300005544 Unclassified 1313
25 Ga0070696_100291331 3300005546 Bacteria 1247
26 Ga0070665_100009996 3300005548 Bacteria 9599
27 Ga0070665_101018900 3300005548 Bacteria 840
28 Ga0068866_10596695 3300005718 Bacteria 745
29 Ga0075365_10122916 3300006038 Bacteria 1792
30 Ga0075363_100574591 3300006048 Bacteria 674
31 Ga0075364_10066192 3300006051 Bacteria 2373
32 Ga0075362_10003850 3300006177 Bacteria 5327
33 Ga0075362_10633952 3300006177 Bacteria 554
34 Ga0075369_10093300 3300006186 Bacteria 1345
35 Ga0075366_10315924 3300006195 Bacteria 956
36 Ga0079104_1000623 3300006946 Bacteria 34666
37 Ga0079104_1006144 3300006946 Bacteria 4624
38 Ga0105250_10000388 3300009092 Bacteria 32790
39 Ga0105243_10035579 3300009148 Bacteria 3861
40 Ga0105243_10037414 3300009148 Bacteria 3772
41 Ga0105243_12459990 3300009148 Bacteria 559
42 Ga0105237_12289228 3300009545 Bacteria 550
43 Ga0157323_1010707 3300012495 Bacteria 726
44 Ga0157374_12409819 3300013296 Bacteria 554
45 Ga0163163_11138840 3300014325 Bacteria 843
46 Ga0182008_10001996 3300014497 Bacteria 13096
47 Ga0157379_10626141 3300014968 Bacteria 1006
48 Ga0209435_100019 3300025206 Bacteria 260989
49 Ga0209436_105017 3300025208 Bacteria 3144
50 Ga0207425_1004884 3300025245 Bacteria 3927
51 Ga0209646_1000038 3300025246 Bacteria 353982
52 Ga0209026_1000048 3300025250 Bacteria 257264
53 Ga0209759_1000038 3300025256 Bacteria 257264
54 Ga0209565_1000511 3300025263 Bacteria 28072
55 Ga0209673_1056238 3300025273 Bacteria 1008
56 Ga0209130_1000103 3300025284 Bacteria 137115
57 Ga0209130_1002013 3300025284 Bacteria 11077
58 Ga0209675_1001066 3300025291 Bacteria 16979
59 Ga0209675_1001435 3300025291 Bacteria 13767
60 Ga0209564_1071015 3300025295 Bacteria 723
61 Ga0209758_1068087 3300025297 Bacteria 1135
62 Ga0209050_1004538 3300025298 Bacteria 9334
63 Ga0207426_1000586 3300025302 Bacteria 48467
64 Ga0209051_1020246 3300025303 Bacteria 2872
65 Ga0209257_1009548 3300025304 Bacteria 5158
66 Ga0207696_1002807 3300025711 Bacteria 8267
67 Ga0207688_10193985 3300025901 Bacteria 1216
68 Ga0207709_10000696 3300025935 Bacteria 27115
69 Ga0207709_10064349 3300025935 Bacteria 2302
70 Ga0207691_10242240 3300025940 Bacteria 1559
71 Ga0207691_10338050 3300025940 Bacteria 1289
72 Ga0207651_10045274 3300025960 Bacteria 2950
73 Ga0207639_10000087 3300026041 Bacteria 79236
74 Ga0207678_10965836 3300026067 Bacteria 754
75 Ga0207708_10011753 3300026075 Bacteria 6523
76 Ga0207648_10377445 3300026089 Bacteria 1282
77 Ga0207683_10085464 3300026121 Bacteria 2805
78 Ga0209281_1000072 3300027111 Bacteria 273114
79 Ga0209281_1010496 3300027111 Bacteria 2117
80 Ga0268266_10169403 3300028379 Bacteria 1981
81 Ga0265323_10003286 3300028653 Bacteria 7194
82 Ga0265327_10299769 3300031251 Bacteria 708
83 Ga0265316_10080418 3300031344 Bacteria 2499
84 Ga0265316_10162562 3300031344 Bacteria 1669
85 Ga0265316_10741554 3300031344 Bacteria 691
86 Ga0307408_100084217 3300031548 Bacteria 2384
87 Ga0307516_10017707 3300031730 Bacteria 7423
88 Ga0307516_10121229 3300031730 Bacteria 2405
89 Ga0307405_10783824 3300031731 Bacteria 797
90 Ga0307406_10337488 3300031901 Bacteria 1172
91 Ga0307414_10641166 3300032004 Bacteria 957
92 Ga0373948_0149740 3300034817 Bacteria 582
93 Ga0373928_0068578 3300035084 Bacteria 872
94 Ga0373951_0189907 3300035091 Bacteria 594
95 Ga0373939_0303820 3300035114 Bacteria 637
96 Ga0373931_0999191 3300035691 Bacteria 566
97 Ga0395899_0014965 3300037312 Bacteria 5917
98 Ga0395900_0024903 3300037418 Bacteria 6123
99 Ga0395898_0003864 3300037466 Bacteria 16558
100 Ga0395905_0001870 3300037471 Bacteria 24233
101 Ga0395905_0050491 3300037471 Bacteria 3897
102 Ga0395905_0151595 3300037471 Unclassified 2181
103 Ga0395901_0029137 3300038443 Bacteria 5681
104 Ga0436361_1178762 3300039447 Bacteria 933
105 Ga0451787_099704 3300041441 Bacteria 782
106 Ga0451791_1479488 3300041451 Bacteria 802
107 Ga0451797_0804599 3300041453 Bacteria 587
108 Ga0451795_0706515 3300041456 Bacteria 585
109 Ga0451807_1739638 3300041486 Bacteria 858
110 Ga0451851_0473816 3300041507 Bacteria 819
111 Ga0451843_0473036 3300041509 Bacteria 1746
112 Ga0439455_0131385 3300042012 Bacteria 706
113 Ga0439444_0126776 3300042437 Bacteria 600
114 Ga0439459_0038900 3300042438 Bacteria 1002
115 Ga0439464_0003049 3300042439 Bacteria 4190
116 Ga0451577_0007764 3300042876 Bacteria 10516
117 Ga0451577_0033517 3300042876 Bacteria 4630
118 Ga0451577_0477064 3300042876 Bacteria 1132
119 Ga0451577_0834454 3300042876 Bacteria 832
120 Ga0451577_1099956 3300042876 Bacteria 711
121 Ga0453684_0028145 3300044712 Bacteria 8033
122 Ga0453684_0223094 3300044712 Bacteria 2182
123 Ga0453684_0741881 3300044712 Bacteria 1064
124 Ga0453684_0922067 3300044712 Bacteria 934
125 Ga0453684_2201851 3300044712 Bacteria 550
126 Ga0466967_0205480 3300045976 Bacteria 1867
127 Ga0495639_0650810 3300046475 Bacteria 543
128 Ga0495631_0250920 3300046518 Bacteria 754
129 Ga0495643_0038737 3300046522 Bacteria 2609
130 Ga0495663_0061144 3300046525 Bacteria 1184
131 Ga0495642_0007600 3300046528 Bacteria 4153
132 Ga0495621_0052279 3300046539 Bacteria 1464
133 Ga0495597_0001717 3300046542 Bacteria 15163
134 Ga0495633_0098308 3300046558 Bacteria 1359
135 Ga0495656_0022090 3300046615 Bacteria 2487
136 Ga0495588_0208118 3300046674 Bacteria 1033
137 Ga0495588_0312610 3300046674 Bacteria 827
138 Ga0495669_0012524 3300046684 Bacteria 3611
139 Ga0495670_0102320 3300046691 Bacteria 1476
140 Ga0495636_0094017 3300047318 Bacteria 1304
141 Ga0495677_0015570 3300047445 Bacteria 2763
142 Ga0495685_225396 3300047447 Bacteria 597
143 Ga0495681_0120087 3300047470 Bacteria 1129
144 Ga0495615_0127551 3300048090 Bacteria 741
145 Ga0496111_0777186 3300048914 Bacteria 694
146 Ga0496122_0016221 3300048925 Bacteria 7070
147 Ga0496123_0080931 3300048926 Bacteria 1976
148 Ga0496125_0001050 3300048928 Bacteria 42713
149 Ga0496126_0028407 3300048929 Bacteria 5331
150 Ga0496126_0452855 3300048929 Bacteria 1033
151 Ga0501290_045474 3300049513 Bacteria 670
152 Ga0501036_0580025 3300049572 Bacteria 931
153 Ga0501046_0644179 3300049580 Bacteria 749
154 Ga0501047_0129190 3300049581 Bacteria 2407
155 Ga0501070_1227272 3300049586 Bacteria 575
156 Ga0501228_038219 3300049666 Bacteria 615
157 nmdc:mga03n38_556096_c1 3300050490 Bacteria 649
158 nmdc:mga00v17_21149_c1 3300050491 Bacteria 3737
159 nmdc:mga0yw44_138456_c1 3300050492 Bacteria 1580
160 nmdc:mga0k408_574145_c1 3300050493 Bacteria 666
161 nmdc:mga07m45_578393_c1 3300050496 Bacteria 649
162 Ga0500618_040190 3300053125 Bacteria 1075
163 Ga0500622_0100965 3300053156 Bacteria 1421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100009996 Ga0070665_10000999616 84
2 3300006048 Ga0075363_100574591 Ga0075363_1005745912 84
3 3300014497 Ga0182008_10001996 Ga0182008_1000199611 84
4 3300025901 Ga0207688_10193985 Ga0207688_101939852 84
5 3300025960 Ga0207651_10045274 Ga0207651_100452744 84
6 3300026121 Ga0207683_10085464 Ga0207683_100854642 84
7 3300028379 Ga0268266_10169403 Ga0268266_101694032 84
8 3300041456 Ga0451795_0706515 Ga0451795_0706515_165_419 84
9 3300046475 Ga0495639_0650810 Ga0495639_0650810_161_415 84
10 3300046522 Ga0495643_0038737 Ga0495643_0038737_765_1019 84
11 iso_pu_bacteria 2511231002 2511244983 85
12 iso_pu_bacteria 2721755523 2722881238 85
13 iso_pu_bacteria 2839138175 2839142966 85
14 iso_pu_bacteria 2904434214 2904435126 85
15 iso_pu_bacteria 2939631187 2939634272 85
16 iso_pu_bacteria 8048746797 8048750056 85
17 3300005539 Ga0068853_100000060 Ga0068853_10000006063 88
18 3300005544 Ga0070686_100242351 Ga0070686_1002423512 88
19 3300006177 Ga0075362_10633952 Ga0075362_106339522 88
20 3300013296 Ga0157374_12409819 Ga0157374_124098191 88
21 3300014325 Ga0163163_11138840 Ga0163163_111388402 88
22 3300026041 Ga0207639_10000087 Ga0207639_100000879 88
23 3300037471 Ga0395905_0151595 Ga0395905_0151595_286_579 88
24 3300041486 Ga0451807_1739638 Ga0451807_1739638_398_688 88
25 iso_pu_bacteria 2547132512 2548847254 88
26 3300002705 JGI25156J39149_1000040 JGI25156J39149_100004081 89
27 3300002738 JGI25154J39366_1000060 JGI25154J39366_100006037 89
28 3300002741 JGI25157J39369_1000058 JGI25157J39369_100005837 89
29 3300002774 JGI25150J39212_1030202 JGI25150J39212_10302022 89
30 3300002987 JGI25159J45721_1000140 JGI25159J45721_100014035 89
31 3300003354 JGI25160J50197_1000198 JGI25160J50197_100019826 89
32 3300003374 JGI25161J50226_1000021 JGI25161J50226_1000021129 89
33 3300003773 Ga0055537_1008598 Ga0055537_10085982 89
34 3300003781 Ga0055536_1079976 Ga0055536_10799761 89
35 3300003784 Ga0055534_1001448 Ga0055534_10014484 89
36 3300003784 Ga0055534_1026194 Ga0055534_10261941 89
37 3300003791 Ga0055530_10046641 Ga0055530_100466411 89
38 3300004625 Ga0055543_1000238 Ga0055543_10002389 89
39 3300005289 Ga0065704_10081947 Ga0065704_100819474 89
40 3300005336 Ga0070680_101002784 Ga0070680_1010027841 89
41 3300005345 Ga0070692_10327559 Ga0070692_103275592 89
42 3300005440 Ga0070705_101728868 Ga0070705_1017288682 89
43 3300005441 Ga0070700_100002610 Ga0070700_1000026106 89
44 3300005459 Ga0068867_100185820 Ga0068867_1001858202 89
45 3300005466 Ga0070685_11231617 Ga0070685_112316171 89
46 3300005543 Ga0070672_100264511 Ga0070672_1002645113 89
47 3300005543 Ga0070672_100838953 Ga0070672_1008389532 89
48 3300005546 Ga0070696_100291331 Ga0070696_1002913312 89
49 3300005548 Ga0070665_101018900 Ga0070665_1010189002 89
50 3300005718 Ga0068866_10596695 Ga0068866_105966952 89
51 3300006038 Ga0075365_10122916 Ga0075365_101229163 89
52 3300006051 Ga0075364_10066192 Ga0075364_100661923 89
53 3300006177 Ga0075362_10003850 Ga0075362_100038505 89
54 3300006186 Ga0075369_10093300 Ga0075369_100933003 89
55 3300006195 Ga0075366_10315924 Ga0075366_103159243 89
56 3300006946 Ga0079104_1000623 Ga0079104_100062332 89
57 3300006946 Ga0079104_1006144 Ga0079104_10061442 89
58 3300009092 Ga0105250_10000388 Ga0105250_1000038820 89
59 3300009148 Ga0105243_10035579 Ga0105243_100355794 89
60 3300009148 Ga0105243_10037414 Ga0105243_100374145 89
61 3300009148 Ga0105243_12459990 Ga0105243_124599902 89
62 3300009545 Ga0105237_12289228 Ga0105237_122892281 89
63 3300012495 Ga0157323_1010707 Ga0157323_10107071 89
64 3300014968 Ga0157379_10626141 Ga0157379_106261413 89
65 3300025206 Ga0209435_100019 Ga0209435_10001937 89
66 3300025208 Ga0209436_105017 Ga0209436_1050172 89
67 3300025245 Ga0207425_1004884 Ga0207425_10048843 89
68 3300025246 Ga0209646_1000038 Ga0209646_100003837 89
69 3300025250 Ga0209026_1000048 Ga0209026_100004837 89
70 3300025256 Ga0209759_1000038 Ga0209759_1000038207 89
71 3300025263 Ga0209565_1000511 Ga0209565_100051116 89
72 3300025273 Ga0209673_1056238 Ga0209673_10562382 89
73 3300025284 Ga0209130_1000103 Ga0209130_100010335 89
74 3300025284 Ga0209130_1002013 Ga0209130_10020139 89
75 3300025291 Ga0209675_1001066 Ga0209675_100106616 89
76 3300025291 Ga0209675_1001435 Ga0209675_10014353 89
77 3300025295 Ga0209564_1071015 Ga0209564_10710152 89
78 3300025297 Ga0209758_1068087 Ga0209758_10680872 89
79 3300025298 Ga0209050_1004538 Ga0209050_10045388 89
80 3300025302 Ga0207426_1000586 Ga0207426_100058635 89
81 3300025303 Ga0209051_1020246 Ga0209051_10202462 89
82 3300025304 Ga0209257_1009548 Ga0209257_10095484 89
83 3300025711 Ga0207696_1002807 Ga0207696_10028072 89
84 3300025935 Ga0207709_10000696 Ga0207709_100006965 89
85 3300025935 Ga0207709_10064349 Ga0207709_100643492 89
86 3300025940 Ga0207691_10242240 Ga0207691_102422403 89
87 3300025940 Ga0207691_10338050 Ga0207691_103380503 89
88 3300026067 Ga0207678_10965836 Ga0207678_109658361 89
89 3300026075 Ga0207708_10011753 Ga0207708_100117535 89
90 3300026089 Ga0207648_10377445 Ga0207648_103774451 89
91 3300027111 Ga0209281_1000072 Ga0209281_1000072142 89
92 3300027111 Ga0209281_1010496 Ga0209281_10104962 89
93 3300028653 Ga0265323_10003286 Ga0265323_100032867 89
94 3300031251 Ga0265327_10299769 Ga0265327_102997692 89
95 3300031344 Ga0265316_10080418 Ga0265316_100804183 89
96 3300031344 Ga0265316_10162562 Ga0265316_101625622 89
97 3300031344 Ga0265316_10741554 Ga0265316_107415542 89
98 3300031548 Ga0307408_100084217 Ga0307408_1000842172 89
99 3300031730 Ga0307516_10017707 Ga0307516_100177071 89
100 3300031730 Ga0307516_10121229 Ga0307516_101212293 89
101 3300031731 Ga0307405_10783824 Ga0307405_107838242 89
102 3300031901 Ga0307406_10337488 Ga0307406_103374882 89
103 3300032004 Ga0307414_10641166 Ga0307414_106411663 89
104 3300034817 Ga0373948_0149740 Ga0373948_0149740_292_561 89
105 3300035084 Ga0373928_0068578 Ga0373928_0068578_368_637 89
106 3300035091 Ga0373951_0189907 Ga0373951_0189907_139_408 89
107 3300035114 Ga0373939_0303820 Ga0373939_0303820_73_342 89
108 3300035691 Ga0373931_0999191 Ga0373931_0999191_205_474 89
109 3300037312 Ga0395899_0014965 Ga0395899_0014965_1670_1939 89
110 3300037418 Ga0395900_0024903 Ga0395900_0024903_4537_4806 89
111 3300037466 Ga0395898_0003864 Ga0395898_0003864_12505_12774 89
112 3300037471 Ga0395905_0001870 Ga0395905_0001870_14696_14965 89
113 3300037471 Ga0395905_0050491 Ga0395905_0050491_1074_1343 89
114 3300038443 Ga0395901_0029137 Ga0395901_0029137_1194_1463 89
115 3300039447 Ga0436361_1178762 Ga0436361_1178762_355_624 89
116 3300041441 Ga0451787_099704 Ga0451787_099704_114_383 89
117 3300041451 Ga0451791_1479488 Ga0451791_1479488_86_355 89
118 3300041453 Ga0451797_0804599 Ga0451797_0804599_54_323 89
119 3300041507 Ga0451851_0473816 Ga0451851_0473816_158_427 89
120 3300041509 Ga0451843_0473036 Ga0451843_0473036_294_563 89
121 3300042012 Ga0439455_0131385 Ga0439455_0131385_71_340 89
122 3300042437 Ga0439444_0126776 Ga0439444_0126776_145_414 89
123 3300042438 Ga0439459_0038900 Ga0439459_0038900_48_317 89
124 3300042439 Ga0439464_0003049 Ga0439464_0003049_1150_1419 89
125 3300042876 Ga0451577_0007764 Ga0451577_0007764_7083_7394 89
126 3300042876 Ga0451577_0033517 Ga0451577_0033517_2475_2744 89
127 3300042876 Ga0451577_0477064 Ga0451577_0477064_841_1110 89
128 3300042876 Ga0451577_0834454 Ga0451577_0834454_199_468 89
129 3300042876 Ga0451577_1099956 Ga0451577_1099956_307_576 89
130 3300044712 Ga0453684_0028145 Ga0453684_0028145_889_1158 89
131 3300044712 Ga0453684_0223094 Ga0453684_0223094_421_690 89
132 3300044712 Ga0453684_0741881 Ga0453684_0741881_699_968 89
133 3300044712 Ga0453684_0922067 Ga0453684_0922067_126_395 89
134 3300044712 Ga0453684_2201851 Ga0453684_2201851_162_431 89
135 3300045976 Ga0466967_0205480 Ga0466967_0205480_989_1258 89
136 3300046518 Ga0495631_0250920 Ga0495631_0250920_270_539 89
137 3300046525 Ga0495663_0061144 Ga0495663_0061144_456_725 89
138 3300046528 Ga0495642_0007600 Ga0495642_0007600_2444_2713 89
139 3300046539 Ga0495621_0052279 Ga0495621_0052279_416_685 89
140 3300046542 Ga0495597_0001717 Ga0495597_0001717_5427_5696 89
141 3300046558 Ga0495633_0098308 Ga0495633_0098308_464_733 89
142 3300046615 Ga0495656_0022090 Ga0495656_0022090_1741_2010 89
143 3300046674 Ga0495588_0208118 Ga0495588_0208118_57_326 89
144 3300046674 Ga0495588_0312610 Ga0495588_0312610_513_782 89
145 3300046684 Ga0495669_0012524 Ga0495669_0012524_953_1222 89
146 3300046691 Ga0495670_0102320 Ga0495670_0102320_80_349 89
147 3300047318 Ga0495636_0094017 Ga0495636_0094017_640_909 89
148 3300047445 Ga0495677_0015570 Ga0495677_0015570_1404_1673 89
149 3300047447 Ga0495685_225396 Ga0495685_225396_31_300 89
150 3300047470 Ga0495681_0120087 Ga0495681_0120087_377_646 89
151 3300048090 Ga0495615_0127551 Ga0495615_0127551_448_717 89
152 3300048914 Ga0496111_0777186 Ga0496111_0777186_324_593 89
153 3300048925 Ga0496122_0016221 Ga0496122_0016221_3055_3324 89
154 3300048926 Ga0496123_0080931 Ga0496123_0080931_1605_1874 89
155 3300048928 Ga0496125_0001050 Ga0496125_0001050_39461_39730 89
156 3300048929 Ga0496126_0028407 Ga0496126_0028407_2712_2981 89
157 3300048929 Ga0496126_0452855 Ga0496126_0452855_730_999 89
158 3300049513 Ga0501290_045474 Ga0501290_045474_176_445 89
159 3300049572 Ga0501036_0580025 Ga0501036_0580025_350_619 89
160 3300049580 Ga0501046_0644179 Ga0501046_0644179_41_310 89
161 3300049581 Ga0501047_0129190 Ga0501047_0129190_405_674 89
162 3300049586 Ga0501070_1227272 Ga0501070_1227272_181_450 89
163 3300049666 Ga0501228_038219 Ga0501228_038219_204_473 89
164 3300050490 nmdc:mga03n38_556096_c1 nmdc:mga03n38_556096_c1_194_463 89
165 3300050491 nmdc:mga00v17_21149_c1 nmdc:mga00v17_21149_c1_824_1093 89
166 3300050492 nmdc:mga0yw44_138456_c1 nmdc:mga0yw44_138456_c1_857_1126 89
167 3300050493 nmdc:mga0k408_574145_c1 nmdc:mga0k408_574145_c1_53_322 89
168 3300050496 nmdc:mga07m45_578393_c1 nmdc:mga07m45_578393_c1_71_340 89
169 3300053125 Ga0500618_040190 Ga0500618_040190_258_527 89
170 3300053156 Ga0500622_0100965 Ga0500622_0100965_56_325 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00381

PTS-HPr

PTS HPr component phosphorylation site

12

93

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ff5-assembly3.cif.gz_C the crystal structure of ruminiclostridium cellulolyticum phosphocarrier 0.98 1 77
5ya0-assembly1.cif.gz_C crystal structure of lsrk and hpr complex 0.9717 1 83
3ihs-assembly2.cif.gz_B crystal structure of a phosphocarrier protein hpr from bacillus anthracis str. ames 0.9706 2 79
3ccd-assembly1.cif.gz_A 1.0 a structure of post-succinimide his15asp hpr 0.9701 1 83
2hpr-assembly1.cif.gz_A histidine-containing phosphocarrier protein hpr mutant with met 51 replaced by val and ser 83 replaced by cys (m51v, s83c) 0.9679 2 82
ID Description Score Start End Superfamily
3ccdB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9704 1 83 3.30.1340.10
3ihsB00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9693 2 79 3.30.1340.10
af_P37349_156_242_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9615 2 86 3.30.1340.10
af_P69811_287_371_3.30.1340.10 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9597 4 82 3.30.1340.10
1pchA00 Alpha Beta;2-Layer Sandwich;Histidine-containing Protein; Chain: A;;HPr-like 0.9513 2 83 3.30.1340.10
ID Description Score Start End GO Terms
AF-A0A521Y6V3-F1-model_v4 HPr family phosphocarrier protein 1.001 1 86 GO:0005737
GO:0009401
AF-A0A7W7Y624-F1-model_v4 Phosphotransferase system HPr (HPr) family protein 1 2 86 GO:0005737
GO:0009401
GO:0016740
AF-A0A239A1A9-F1-model_v4 Phosphocarrier protein 0.9998 2 86 GO:0005737
GO:0009401
AF-A0A353QKE9-F1-model_v4 deleted 0.9996 2 86
AF-A0A212PHL2-F1-model_v4 Phosphocarrier protein 0.9991 2 86 GO:0005737
GO:0009401

Feature Viewer

pLDDT pTM Quality
94.86 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map