F256306

General Info

Members Datasets Scaffolds Average Seq Length
170 116 340 65

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10600625|Ga0070681_106006252
Length 76
Sequence MHGALRKASGVKIVVDRDLCQGHAVCESEAAEVFTVPKNGTVEVLDPSPPAELRAKVEAAVKYCPTHALRIIDEED

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
4 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
54 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
62 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
63 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
64 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
65 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
66 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
67 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
88 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
91 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
92 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
93 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
106 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
113 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 1.18
Rhizosphere 93.53
Stem 0
Stem Tuber 0
Unclassified 4.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10600625 3300005458 Bacteria 1015
2 rootH1_10036579 3300003323 Bacteria 1945
3 Ga0070674_100791226 3300005356 Bacteria 818
4 Ga0070703_10429097 3300005406 Bacteria 581
5 Ga0070710_10127685 3300005437 Bacteria 1547
6 Ga0070708_100000546 3300005445 Bacteria 28120
7 Ga0070708_100008520 3300005445 Bacteria 8238
8 Ga0070708_100042658 3300005445 Bacteria 3984
9 Ga0070708_100173059 3300005445 Bacteria 2016
10 Ga0070708_100533224 3300005445 Bacteria 1107
11 Ga0070708_101571426 3300005445 Unclassified 612
12 Ga0070681_10019150 3300005458 Bacteria 6849
13 Ga0070706_100063628 3300005467 Bacteria 3409
14 Ga0070706_100082544 3300005467 Bacteria 2977
15 Ga0070706_100455174 3300005467 Bacteria 1191
16 Ga0070706_100492285 3300005467 Bacteria 1141
17 Ga0070707_100013782 3300005468 Bacteria 7571
18 Ga0070707_100054045 3300005468 Bacteria 3850
19 Ga0070707_100289943 3300005468 Bacteria 1590
20 Ga0070707_100314095 3300005468 Bacteria 1523
21 Ga0070707_100376730 3300005468 Bacteria 1379
22 Ga0070707_101850868 3300005468 Bacteria 571
23 Ga0070698_100009414 3300005471 Bacteria 10468
24 Ga0070698_100240761 3300005471 Bacteria 1742
25 Ga0070698_100297239 3300005471 Bacteria 1545
26 Ga0070698_101039651 3300005471 Unclassified 767
27 Ga0070698_101066609 3300005471 Bacteria 756
28 Ga0070698_101488226 3300005471 Bacteria 628
29 Ga0070699_100370488 3300005518 Bacteria 1292
30 Ga0070699_100934171 3300005518 Bacteria 795
31 Ga0070679_101221861 3300005530 Bacteria 697
32 Ga0070697_100134680 3300005536 Bacteria 2074
33 Ga0070697_100166670 3300005536 Bacteria 1863
34 Ga0068853_100525450 3300005539 Bacteria 1119
35 Ga0070696_101390936 3300005546 Bacteria 598
36 Ga0070693_101580960 3300005547 Unclassified 514
37 Ga0070704_100595579 3300005549 Bacteria 971
38 Ga0068856_100244812 3300005614 Bacteria 1808
39 Ga0068856_100579911 3300005614 Bacteria 1143
40 Ga0070717_10891693 3300006028 Bacteria 810
41 Ga0070715_11037406 3300006163 Unclassified 513
42 Ga0070716_100034089 3300006173 Bacteria 2789
43 Ga0070712_101298400 3300006175 Bacteria 634
44 Ga0075428_100000002 3300006844 Bacteria 546374
45 Ga0075434_100448818 3300006871 Bacteria 1311
46 Ga0075434_100778088 3300006871 Bacteria 974
47 Ga0075434_102293662 3300006871 Bacteria 543
48 Ga0075435_100008929 3300007076 Bacteria 7225
49 Ga0099795_10480957 3300007788 Bacteria 576
50 Ga0114129_13085847 3300009147 Bacteria 545
51 Ga0105241_12307852 3300009174 Bacteria 536
52 Ga0105242_12527659 3300009176 Bacteria 562
53 Ga0105242_12615345 3300009176 Bacteria 554
54 Ga0105237_12626795 3300009545 Bacteria 514
55 Ga0105147_111376 3300009982 Bacteria 756
56 Ga0157369_10900296 3300013105 Bacteria 907
57 Ga0157374_11113355 3300013296 Bacteria 810
58 Ga0157376_12499157 3300014969 Bacteria 556
59 Ga0206356_11491120 3300020070 Bacteria 736
60 Ga0213876_10065043 3300021384 Bacteria 1925
61 Ga0207692_10610545 3300025898 Unclassified 702
62 Ga0207684_10067828 3300025910 Bacteria 3032
63 Ga0207684_10190110 3300025910 Bacteria 1771
64 Ga0207684_10293914 3300025910 Bacteria 1401
65 Ga0207684_10454166 3300025910 Bacteria 1100
66 Ga0207684_10528595 3300025910 Bacteria 1010
67 Ga0207707_10122117 3300025912 Bacteria 2277
68 Ga0207660_10492995 3300025917 Bacteria 994
69 Ga0207646_10009167 3300025922 Bacteria 9812
70 Ga0207646_10031041 3300025922 Bacteria 4839
71 Ga0207646_10177847 3300025922 Bacteria 1922
72 Ga0207646_10209660 3300025922 Bacteria 1760
73 Ga0207646_11334357 3300025922 Bacteria 625
74 Ga0207709_11422141 3300025935 Bacteria 574
75 Ga0207670_11800492 3300025936 Bacteria 521
76 Ga0207639_10806137 3300026041 Bacteria 875
77 Ga0207702_10316928 3300026078 Bacteria 1484
78 Ga0207698_11614821 3300026142 Bacteria 664
79 Ga0209179_1124346 3300027512 Bacteria 576
80 Ga0307511_10409872 3300030521 Unclassified 553
81 Ga0265763_1021295 3300030763 Bacteria 684
82 Ga0265327_10000477 3300031251 Bacteria 70613
83 Ga0265327_10139299 3300031251 Bacteria 1135
84 Ga0307405_10244765 3300031731 Bacteria 1331
85 Ga0307413_10574848 3300031824 Unclassified 918
86 Ga0307413_11692265 3300031824 Bacteria 564
87 Ga0307410_10011218 3300031852 Bacteria 5115
88 Ga0307410_11049311 3300031852 Bacteria 705
89 Ga0307406_10508508 3300031901 Bacteria 978
90 Ga0307412_10185355 3300031911 Bacteria 1569
91 Ga0307412_10629841 3300031911 Bacteria 912
92 Ga0307409_100247971 3300031995 Bacteria 1626
93 Ga0307416_100304204 3300032002 Unclassified 1587
94 Ga0307416_100863569 3300032002 Bacteria 1003
95 Ga0307414_10087576 3300032004 Bacteria 2302
96 Ga0307411_10008644 3300032005 Bacteria 5293
97 Ga0307415_100934217 3300032126 Bacteria 802
98 Ga0436364_0743578 3300037853 Bacteria 850
99 Ga0436365_1040631 3300039437 Bacteria 1690
100 Ga0436362_0444072 3300039453 Bacteria 1915
101 Ga0451791_1445700 3300041451 Bacteria 643
102 Ga0451793_1597540 3300041452 Bacteria 536
103 Ga0451845_0228284 3300041501 Bacteria 900
104 Ga0439445_0202997 3300042004 Bacteria 586
105 Ga0439452_014437 3300042010 Bacteria 2194
106 Ga0439458_0141189 3300042157 Bacteria 642
107 Ga0439434_0008207 3300042435 Bacteria 3062
108 Ga0439434_0186658 3300042435 Bacteria 696
109 Ga0466972_0105747 3300044658 Bacteria 1331
110 Ga0466972_0268213 3300044658 Bacteria 798
111 Ga0466972_0446219 3300044658 Bacteria 608
112 Ga0466965_0585805 3300044683 Bacteria 633
113 Ga0466966_0042826 3300044684 Bacteria 2904
114 Ga0466966_0105774 3300044684 Bacteria 1737
115 Ga0466961_0003617 3300044693 Bacteria 9633
116 Ga0466961_0022099 3300044693 Bacteria 4093
117 Ga0466963_0100652 3300044694 Bacteria 1978
118 Ga0466971_0150241 3300044719 Bacteria 1087
119 Ga0466968_0153123 3300044735 Bacteria 1061
120 Ga0466970_0084603 3300044765 Bacteria 1717
121 Ga0466957_0203057 3300044842 Bacteria 1303
122 Ga0466960_0045244 3300044901 Bacteria 2102
123 Ga0466959_0019669 3300045049 Bacteria 4967
124 Ga0466959_0060931 3300045049 Bacteria 2745
125 Ga0466959_0142326 3300045049 Bacteria 1694
126 Ga0466958_0025247 3300045836 Bacteria 3502
127 Ga0466958_0137362 3300045836 Bacteria 1538
128 Ga0466967_0497261 3300045976 Bacteria 1196
129 Ga0495592_0452965 3300046454 Bacteria 804
130 Ga0495586_0117350 3300046535 Bacteria 1485
131 Ga0495667_0914436 3300046559 Bacteria 538
132 Ga0495657_0115119 3300046675 Bacteria 1699
133 Ga0495600_0373538 3300046809 Bacteria 890
134 Ga0495604_0202791 3300047317 Bacteria 1375
135 Ga0495674_0049742 3300047319 Bacteria 3702
136 Ga0495680_0106387 3300047322 Bacteria 2085
137 Ga0495684_0039630 3300047471 Bacteria 3612
138 Ga0495602_0591028 3300048088 Bacteria 765
139 Ga0496126_1151929 3300048929 Bacteria 573
140 Ga0501034_0594057 3300049571 Bacteria 1013
141 Ga0501067_0002723 3300049583 Bacteria 9721
142 Ga0501067_0061786 3300049583 Bacteria 2074
143 Ga0501068_0015950 3300049584 Bacteria 4327
144 Ga0501069_0003187 3300049585 Bacteria 8403
145 Ga0501069_0444038 3300049585 Bacteria 771
146 Ga0501070_0089558 3300049586 Bacteria 2546
147 Ga0501070_0426222 3300049586 Bacteria 1071
148 Ga0501071_0006179 3300049587 Bacteria 7765
149 Ga0501071_0625763 3300049587 Bacteria 828
150 Ga0501073_0019357 3300049589 Bacteria 4915
151 Ga0501073_0869347 3300049589 Bacteria 621
152 Ga0501074_0137422 3300049590 Bacteria 1748
153 Ga0501076_0982331 3300049592 Bacteria 696
154 Ga0501076_1577926 3300049592 Bacteria 539
155 Ga0501079_0021172 3300049741 Bacteria 4972
156 Ga0501080_0011003 3300049742 Bacteria 8282
157 Ga0501080_0065589 3300049742 Bacteria 3377
158 Ga0501083_0002566 3300049744 Bacteria 12487
159 Ga0501083_0229804 3300049744 Bacteria 1208
160 nmdc:mga0qj67_876914_c1 3300050509 Bacteria 708
161 nmdc:mga08y16_1170444_c1 3300050511 Bacteria 741
162 nmdc:mga0n895_2249199_c1 3300050512 Bacteria 500
163 nmdc:mga0rr50_6218_c1 3300050513 Bacteria 7238
164 nmdc:mga08x19_153357_c1 3300050514 Bacteria 1561
165 Ga0495619_0059665 3300053085 Bacteria 2535
166 Ga0500641_0231210 3300053096 Bacteria 781
167 Ga0500604_0037076 3300053151 Bacteria 1456
168 Ga0501084_0010396 3300054114 Bacteria 7694
169 Ga0501082_0026926 3300060353 Bacteria 4954
170 Ga0466962_0193881 3300061719 Bacteria 991
171 Ga0070681_10600625
172 rootH1_10036579
173 Ga0070674_100791226
174 Ga0070703_10429097
175 Ga0070710_10127685
176 Ga0070708_100000546
177 Ga0070708_100008520
178 Ga0070708_100042658
179 Ga0070708_100173059
180 Ga0070708_100533224
181 Ga0070708_101571426
182 Ga0070681_10019150
183 Ga0070706_100063628
184 Ga0070706_100082544
185 Ga0070706_100455174
186 Ga0070706_100492285
187 Ga0070707_100013782
188 Ga0070707_100054045
189 Ga0070707_100289943
190 Ga0070707_100314095
191 Ga0070707_100376730
192 Ga0070707_101850868
193 Ga0070698_100009414
194 Ga0070698_100240761
195 Ga0070698_100297239
196 Ga0070698_101039651
197 Ga0070698_101066609
198 Ga0070698_101488226
199 Ga0070699_100370488
200 Ga0070699_100934171
201 Ga0070679_101221861
202 Ga0070697_100134680
203 Ga0070697_100166670
204 Ga0068853_100525450
205 Ga0070696_101390936
206 Ga0070693_101580960
207 Ga0070704_100595579
208 Ga0068856_100244812
209 Ga0068856_100579911
210 Ga0070717_10891693
211 Ga0070715_11037406
212 Ga0070716_100034089
213 Ga0070712_101298400
214 Ga0075428_100000002
215 Ga0075434_100448818
216 Ga0075434_100778088
217 Ga0075434_102293662
218 Ga0075435_100008929
219 Ga0099795_10480957
220 Ga0114129_13085847
221 Ga0105241_12307852
222 Ga0105242_12527659
223 Ga0105242_12615345
224 Ga0105237_12626795
225 Ga0105147_111376
226 Ga0157369_10900296
227 Ga0157374_11113355
228 Ga0157376_12499157
229 Ga0206356_11491120
230 Ga0213876_10065043
231 Ga0207692_10610545
232 Ga0207684_10067828
233 Ga0207684_10190110
234 Ga0207684_10293914
235 Ga0207684_10454166
236 Ga0207684_10528595
237 Ga0207707_10122117
238 Ga0207660_10492995
239 Ga0207646_10009167
240 Ga0207646_10031041
241 Ga0207646_10177847
242 Ga0207646_10209660
243 Ga0207646_11334357
244 Ga0207709_11422141
245 Ga0207670_11800492
246 Ga0207639_10806137
247 Ga0207702_10316928
248 Ga0207698_11614821
249 Ga0209179_1124346
250 Ga0307511_10409872
251 Ga0265763_1021295
252 Ga0265327_10000477
253 Ga0265327_10139299
254 Ga0307405_10244765
255 Ga0307413_10574848
256 Ga0307413_11692265
257 Ga0307410_10011218
258 Ga0307410_11049311
259 Ga0307406_10508508
260 Ga0307412_10185355
261 Ga0307412_10629841
262 Ga0307409_100247971
263 Ga0307416_100304204
264 Ga0307416_100863569
265 Ga0307414_10087576
266 Ga0307411_10008644
267 Ga0307415_100934217
268 Ga0436364_0743578
269 Ga0436365_1040631
270 Ga0436362_0444072
271 Ga0451791_1445700
272 Ga0451793_1597540
273 Ga0451845_0228284
274 Ga0439445_0202997
275 Ga0439452_014437
276 Ga0439458_0141189
277 Ga0439434_0008207
278 Ga0439434_0186658
279 Ga0466972_0105747
280 Ga0466972_0268213
281 Ga0466972_0446219
282 Ga0466965_0585805
283 Ga0466966_0042826
284 Ga0466966_0105774
285 Ga0466961_0003617
286 Ga0466961_0022099
287 Ga0466963_0100652
288 Ga0466971_0150241
289 Ga0466968_0153123
290 Ga0466970_0084603
291 Ga0466957_0203057
292 Ga0466960_0045244
293 Ga0466959_0019669
294 Ga0466959_0060931
295 Ga0466959_0142326
296 Ga0466958_0025247
297 Ga0466958_0137362
298 Ga0466967_0497261
299 Ga0495592_0452965
300 Ga0495586_0117350
301 Ga0495667_0914436
302 Ga0495657_0115119
303 Ga0495600_0373538
304 Ga0495604_0202791
305 Ga0495674_0049742
306 Ga0495680_0106387
307 Ga0495684_0039630
308 Ga0495602_0591028
309 Ga0496126_1151929
310 Ga0501034_0594057
311 Ga0501067_0002723
312 Ga0501067_0061786
313 Ga0501068_0015950
314 Ga0501069_0003187
315 Ga0501069_0444038
316 Ga0501070_0089558
317 Ga0501070_0426222
318 Ga0501071_0006179
319 Ga0501071_0625763
320 Ga0501073_0019357
321 Ga0501073_0869347
322 Ga0501074_0137422
323 Ga0501076_0982331
324 Ga0501076_1577926
325 Ga0501079_0021172
326 Ga0501080_0011003
327 Ga0501080_0065589
328 Ga0501083_0002566
329 Ga0501083_0229804
330 nmdc:mga0qj67_876914_c1
331 nmdc:mga08y16_1170444_c1
332 nmdc:mga0n895_2249199_c1
333 nmdc:mga0rr50_6218_c1
334 nmdc:mga08x19_153357_c1
335 Ga0495619_0059665
336 Ga0500641_0231210
337 Ga0500604_0037076
338 Ga0501084_0010396
339 Ga0501082_0026926
340 Ga0466962_0193881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13459

Fer4_15

4Fe-4S single cluster domain

13

71

0.96

PF06902

Fer4_19

Divergent 4Fe-4S mono-cluster

7

74

0.93

PF13370

Fer4_13

4Fe-4S single cluster domain of Ferredoxin I

15

71

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8amp-assembly1.cif.gz_A crystal structure of m.tuberculosis ferredoxin fdx 0.9711 3 67
8amp-assembly1.cif.gz_A crystal structure of m.tuberculosis ferredoxin fdx 0.9568 3 67
1vjw-assembly1.cif.gz_A structure of oxidoreductase (nadp+(a),ferredoxin(a)) 0.9185 5 63
1siz-assembly1.cif.gz_C crystal structure of the [fe3s4]-ferredoxin from the hyperthermophilic archaeon pyrococcus furiosus 0.8903 4 67
3pni-assembly1.cif.gz_A crystal structure of d14c [3fe-4s] pyrococcus furiosus ferredoxin 0.8896 4 67
ID Description Score Start End Superfamily
af_P71820_2_65_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9788 3 65 3.30.70.20
af_P71820_2_65_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9492 3 65 3.30.70.20
af_I6X7H4_1_61_3.30.70.20 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9266 5 63 3.30.70.20
1vjwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9185 5 63 3.30.70.20
3pniA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8896 4 67 3.30.70.20
ID Description Score Start End GO Terms
AF-A0A6J4IWV8-F1-model_v4 Ferredoxin 0.9987 4 65 GO:0005506
GO:0009055
GO:0051538
AF-A0A3C1CHN9-F1-model_v4 Ferredoxin 0.9986 4 65 GO:0005506
GO:0009055
GO:0051538
AF-A0A0S9Q7C6-F1-model_v4 Ferredoxin 0.9942 5 63 GO:0005506
GO:0009055
GO:0051538
AF-A0A1Z9BPN3-F1-model_v4 Ferredoxin 0.9934 5 63 GO:0046872
GO:0051536
AF-A0A1I6RFD0-F1-model_v4 Ferredoxin 0.992 5 67 GO:0046872
GO:0051538

Map