F255155

General Info

Members Datasets Scaffolds Average Seq Length
169 123 338 258

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0164231|Ga0395898_0164231_1255_2061
Length 268
Sequence MDLELDGKVAVITAAGGGIGLAATRALASEGARVVAGSRTTESLQQLPGVTAVAIDLMEPDAPADLVAQAITEHGRVDVLVNNLGAAQLRLDGFLATTDEDFQWAFEINFFSAVRATRAALADMVEHGSGAVVNVASVNSFYHPDSVVEPDGGVVDYGAAKAALVNLTKALSQEFGPRGIRINSISPGPVATDFWLGPKGVAATVGARMGVDADTARERIVAGMGGIPTGRFTTPEEVATLIVLLASERTANVTGANYVIDGGLIKTT

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
52 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
55 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
56 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
63 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
64 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
96 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
97 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
98 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
99 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
100 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
101 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
102 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
103 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
104 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
105 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
117 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
118 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0
Rhizoplane 10.65
Rhizosphere 68.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0164231 3300037466 Bacteria 2124
2 rootH1_10130007 3300003323 Bacteria 7053
3 JGI25407J50210_10007043 3300003373 Bacteria 2813
4 JGI25407J50210_10063257 3300003373 Bacteria 928
5 Ga0065712_10174872 3300005290 Bacteria 1209
6 Ga0070683_100006098 3300005329 Bacteria 10108
7 Ga0070683_100069806 3300005329 Bacteria 3277
8 Ga0070683_100276783 3300005329 Bacteria 1597
9 Ga0070670_100776420 3300005331 Bacteria 864
10 Ga0070689_100167312 3300005340 Bacteria 1780
11 Ga0070668_100345703 3300005347 Bacteria 1258
12 Ga0070688_100455550 3300005365 Bacteria 957
13 Ga0070667_100014725 3300005367 Bacteria 6461
14 Ga0070709_10413810 3300005434 Bacteria 1009
15 Ga0070714_100064482 3300005435 Bacteria 3153
16 Ga0070713_100121491 3300005436 Bacteria 2292
17 Ga0070685_10149412 3300005466 Bacteria 1479
18 Ga0070684_100011046 3300005535 Bacteria 7183
19 Ga0070684_100704696 3300005535 Bacteria 941
20 Ga0070665_100012744 3300005548 Bacteria 8470
21 Ga0070665_100025969 3300005548 Bacteria 5899
22 Ga0068855_100001778 3300005563 Bacteria 26947
23 Ga0068855_100003019 3300005563 Bacteria 20587
24 Ga0068855_100401916 3300005563 Bacteria 1501
25 Ga0068864_100402449 3300005618 Bacteria 1301
26 Ga0068862_100488114 3300005844 Bacteria 1167
27 Ga0081538_10008659 3300005981 Bacteria 8602
28 Ga0081538_10126848 3300005981 Bacteria 1211
29 Ga0070717_10078214 3300006028 Bacteria 2771
30 Ga0070717_10085817 3300006028 Bacteria 2650
31 Ga0070717_10230775 3300006028 Bacteria 1630
32 Ga0070717_10466815 3300006028 Bacteria 1139
33 Ga0075363_100033136 3300006048 Bacteria 2688
34 Ga0075432_10064745 3300006058 Bacteria 1306
35 Ga0070716_100215946 3300006173 Bacteria 1285
36 Ga0075431_100150892 3300006847 Bacteria 2393
37 Ga0075434_100032415 3300006871 Bacteria 5152
38 Ga0075434_100092762 3300006871 Bacteria 3022
39 Ga0075429_100725872 3300006880 Bacteria 870
40 Ga0075435_100017634 3300007076 Bacteria 5409
41 Ga0099795_10133463 3300007788 Bacteria 1004
42 Ga0111539_10073225 3300009094 Bacteria 4039
43 Ga0114129_10298534 3300009147 Bacteria 2148
44 Ga0105248_10248057 3300009177 Bacteria 2004
45 Ga0213874_10004453 3300021377 Bacteria 3201
46 Ga0213874_10005989 3300021377 Bacteria 2858
47 Ga0213874_10029461 3300021377 Bacteria 1575
48 Ga0213876_10019136 3300021384 Bacteria 3616
49 Ga0213876_10118302 3300021384 Bacteria 1406
50 Ga0213875_10023513 3300021388 Bacteria 2943
51 Ga0213875_10056054 3300021388 Bacteria 1845
52 Ga0213875_10242385 3300021388 Bacteria 850
53 Ga0207642_10275712 3300025899 Bacteria 965
54 Ga0207680_10025109 3300025903 Bacteria 3283
55 Ga0207705_10187244 3300025909 Bacteria 1564
56 Ga0207650_10399002 3300025925 Bacteria 1138
57 Ga0207664_10270031 3300025929 Bacteria 1490
58 Ga0207664_10399347 3300025929 Bacteria 1222
59 Ga0207665_10302541 3300025939 Bacteria 1196
60 Ga0207691_10179739 3300025940 Bacteria 1849
61 Ga0207691_10378336 3300025940 Bacteria 1209
62 Ga0207661_10004152 3300025944 Bacteria 10129
63 Ga0207667_10000174 3300025949 Bacteria 94515
64 Ga0207667_10004619 3300025949 Bacteria 16896
65 Ga0207658_10021524 3300025986 Bacteria 4479
66 Ga0207677_10101652 3300026023 Bacteria 2117
67 Ga0207703_10349914 3300026035 Bacteria 1360
68 Ga0207678_10436990 3300026067 Bacteria 1136
69 Ga0207675_100112501 3300026118 Bacteria 2569
70 Ga0268266_10000369 3300028379 Bacteria 69354
71 Ga0268266_10003059 3300028379 Bacteria 17103
72 Ga0265337_1001983 3300028556 Bacteria 9728
73 Ga0265334_10061238 3300028573 Bacteria 1419
74 Ga0307515_10315327 3300028794 Bacteria 1235
75 Ga0265332_10017795 3300031238 Bacteria 3136
76 Ga0265332_10047831 3300031238 Bacteria 1840
77 Ga0265320_10000141 3300031240 Bacteria 61166
78 Ga0265339_10000195 3300031249 Bacteria 50154
79 Ga0265339_10008693 3300031249 Bacteria 6444
80 Ga0265316_10000300 3300031344 Bacteria 55381
81 Ga0265316_10108730 3300031344 Bacteria 2102
82 Ga0307513_10144644 3300031456 Bacteria 2298
83 Ga0307509_10000172 3300031507 Bacteria 102211
84 Ga0307508_10054025 3300031616 Bacteria 3562
85 Ga0265314_10000002 3300031711 Bacteria 2092193
86 Ga0265314_10009082 3300031711 Bacteria 8444
87 Ga0373934_0037368 3300035086 Bacteria 1912
88 Ga0373943_0033312 3300035170 Bacteria 2453
89 Ga0373955_0032246 3300035172 Bacteria 2749
90 Ga0373933_0010244 3300035724 Bacteria 5136
91 Ga0373937_0020842 3300036401 Bacteria 5879
92 Ga0373925_0178172 3300037068 Bacteria 1681
93 Ga0395900_0528368 3300037418 Bacteria 1127
94 Ga0395898_0122548 3300037466 Bacteria 2491
95 Ga0436364_0007301 3300037853 Bacteria 10203
96 Ga0436364_0093103 3300037853 Bacteria 3577
97 Ga0436364_1118827 3300037853 Bacteria 1117
98 Ga0395901_0116312 3300038443 Bacteria 2809
99 Ga0395901_0125997 3300038443 Bacteria 2692
100 Ga0436365_0119491 3300039437 Bacteria 8052
101 Ga0436365_0390484 3300039437 Bacteria 5269
102 Ga0436365_0684177 3300039437 Bacteria 1411
103 Ga0436365_0931037 3300039437 Bacteria 5821
104 Ga0436363_0494400 3300039450 Bacteria 9448
105 Ga0436363_0780168 3300039450 Bacteria 2835
106 Ga0436363_1596444 3300039450 Bacteria 6245
107 Ga0436362_0332199 3300039453 Bacteria 1620
108 Ga0451853_2706100 3300041512 Bacteria 1694
109 Ga0466957_0076595 3300044842 Bacteria 2077
110 Ga0466958_0040539 3300045836 Bacteria 2799
111 Ga0495653_0163573 3300046463 Bacteria 1543
112 Ga0495664_0034912 3300046477 Bacteria 2959
113 Ga0495628_0038537 3300046516 Bacteria 3825
114 Ga0495628_0174066 3300046516 Bacteria 1631
115 Ga0495652_0024610 3300046529 Bacteria 5327
116 Ga0495652_0085579 3300046529 Bacteria 2590
117 Ga0495640_0128947 3300046533 Bacteria 1638
118 Ga0495586_0045315 3300046535 Bacteria 2370
119 Ga0495645_0091085 3300046543 Bacteria 2178
120 Ga0495634_0189911 3300046642 Bacteria 1282
121 Ga0495658_0025805 3300046683 Bacteria 3145
122 Ga0495581_0140479 3300047315 Bacteria 1409
123 Ga0495674_0126453 3300047319 Bacteria 2156
124 Ga0495674_0350564 3300047319 Bacteria 1198
125 Ga0495684_0307520 3300047471 Bacteria 1137
126 Ga0496101_0088678 3300048904 Bacteria 2298
127 Ga0496101_0143611 3300048904 Bacteria 1821
128 Ga0496102_0161185 3300048905 Bacteria 2110
129 Ga0496103_0014354 3300048906 Bacteria 4705
130 Ga0496103_0105813 3300048906 Bacteria 1784
131 Ga0496104_0039190 3300048907 Bacteria 4436
132 Ga0496104_0731268 3300048907 Bacteria 897
133 Ga0496105_0160121 3300048908 Bacteria 1848
134 Ga0496105_0418687 3300048908 Bacteria 1061
135 Ga0496106_0233814 3300048909 Bacteria 1468
136 Ga0496108_0059995 3300048911 Bacteria 3200
137 Ga0496109_0015927 3300048912 Bacteria 6567
138 Ga0496109_0751005 3300048912 Bacteria 913
139 Ga0496110_0150204 3300048913 Bacteria 2109
140 Ga0496111_0151456 3300048914 Bacteria 1720
141 Ga0496112_0131096 3300048915 Bacteria 2478
142 Ga0496114_0060687 3300048917 Bacteria 3161
143 Ga0496115_0066752 3300048918 Bacteria 2908
144 Ga0496117_0011300 3300048920 Bacteria 8007
145 Ga0496118_0000424 3300048921 Bacteria 70137
146 Ga0496119_0108996 3300048922 Bacteria 1540
147 Ga0496120_0004606 3300048923 Bacteria 11448
148 Ga0496121_0053608 3300048924 Bacteria 3377
149 Ga0496124_0008303 3300048927 Bacteria 10874
150 Ga0496124_0025259 3300048927 Bacteria 5384
151 Ga0496126_0347645 3300048929 Bacteria 1213
152 Ga0501036_0032064 3300049572 Bacteria 4439
153 Ga0501047_0088567 3300049581 Bacteria 2972
154 Ga0501047_0352032 3300049581 Bacteria 1309
155 Ga0501083_0134628 3300049744 Bacteria 1619
156 Ga0501044_0124306 3300049823 Bacteria 2578
157 nmdc:mga06r32_7951_c1 3300050510 Bacteria 9530
158 nmdc:mga06r32_800292_c1 3300050510 Bacteria 903
159 nmdc:mga0n895_123413_c1 3300050512 Bacteria 2612
160 nmdc:mga0n895_96452_c1 3300050512 Bacteria 2962
161 nmdc:mga0rr50_33387_c1 3300050513 Bacteria 3675
162 nmdc:mga0a205_214132_c1 3300050515 Bacteria 1814
163 Ga0495601_0071391 3300053077 Bacteria 2217
164 Ga0495612_0157434 3300053078 Bacteria 991
165 Ga0495595_0067455 3300053084 Bacteria 1686
166 Ga0495619_0060569 3300053085 Bacteria 2517
167 Ga0500641_0006560 3300053096 Bacteria 4128
168 Ga0500616_0000273 3300053153 Bacteria 77024
169 Ga0501084_0075439 3300054114 Bacteria 2825
170 Ga0395898_0164231
171 rootH1_10130007
172 JGI25407J50210_10007043
173 JGI25407J50210_10063257
174 Ga0065712_10174872
175 Ga0070683_100006098
176 Ga0070683_100069806
177 Ga0070683_100276783
178 Ga0070670_100776420
179 Ga0070689_100167312
180 Ga0070668_100345703
181 Ga0070688_100455550
182 Ga0070667_100014725
183 Ga0070709_10413810
184 Ga0070714_100064482
185 Ga0070713_100121491
186 Ga0070685_10149412
187 Ga0070684_100011046
188 Ga0070684_100704696
189 Ga0070665_100012744
190 Ga0070665_100025969
191 Ga0068855_100001778
192 Ga0068855_100003019
193 Ga0068855_100401916
194 Ga0068864_100402449
195 Ga0068862_100488114
196 Ga0081538_10008659
197 Ga0081538_10126848
198 Ga0070717_10078214
199 Ga0070717_10085817
200 Ga0070717_10230775
201 Ga0070717_10466815
202 Ga0075363_100033136
203 Ga0075432_10064745
204 Ga0070716_100215946
205 Ga0075431_100150892
206 Ga0075434_100032415
207 Ga0075434_100092762
208 Ga0075429_100725872
209 Ga0075435_100017634
210 Ga0099795_10133463
211 Ga0111539_10073225
212 Ga0114129_10298534
213 Ga0105248_10248057
214 Ga0213874_10004453
215 Ga0213874_10005989
216 Ga0213874_10029461
217 Ga0213876_10019136
218 Ga0213876_10118302
219 Ga0213875_10023513
220 Ga0213875_10056054
221 Ga0213875_10242385
222 Ga0207642_10275712
223 Ga0207680_10025109
224 Ga0207705_10187244
225 Ga0207650_10399002
226 Ga0207664_10270031
227 Ga0207664_10399347
228 Ga0207665_10302541
229 Ga0207691_10179739
230 Ga0207691_10378336
231 Ga0207661_10004152
232 Ga0207667_10000174
233 Ga0207667_10004619
234 Ga0207658_10021524
235 Ga0207677_10101652
236 Ga0207703_10349914
237 Ga0207678_10436990
238 Ga0207675_100112501
239 Ga0268266_10000369
240 Ga0268266_10003059
241 Ga0265337_1001983
242 Ga0265334_10061238
243 Ga0307515_10315327
244 Ga0265332_10017795
245 Ga0265332_10047831
246 Ga0265320_10000141
247 Ga0265339_10000195
248 Ga0265339_10008693
249 Ga0265316_10000300
250 Ga0265316_10108730
251 Ga0307513_10144644
252 Ga0307509_10000172
253 Ga0307508_10054025
254 Ga0265314_10000002
255 Ga0265314_10009082
256 Ga0373934_0037368
257 Ga0373943_0033312
258 Ga0373955_0032246
259 Ga0373933_0010244
260 Ga0373937_0020842
261 Ga0373925_0178172
262 Ga0395900_0528368
263 Ga0395898_0122548
264 Ga0436364_0007301
265 Ga0436364_0093103
266 Ga0436364_1118827
267 Ga0395901_0116312
268 Ga0395901_0125997
269 Ga0436365_0119491
270 Ga0436365_0390484
271 Ga0436365_0684177
272 Ga0436365_0931037
273 Ga0436363_0494400
274 Ga0436363_0780168
275 Ga0436363_1596444
276 Ga0436362_0332199
277 Ga0451853_2706100
278 Ga0466957_0076595
279 Ga0466958_0040539
280 Ga0495653_0163573
281 Ga0495664_0034912
282 Ga0495628_0038537
283 Ga0495628_0174066
284 Ga0495652_0024610
285 Ga0495652_0085579
286 Ga0495640_0128947
287 Ga0495586_0045315
288 Ga0495645_0091085
289 Ga0495634_0189911
290 Ga0495658_0025805
291 Ga0495581_0140479
292 Ga0495674_0126453
293 Ga0495674_0350564
294 Ga0495684_0307520
295 Ga0496101_0088678
296 Ga0496101_0143611
297 Ga0496102_0161185
298 Ga0496103_0014354
299 Ga0496103_0105813
300 Ga0496104_0039190
301 Ga0496104_0731268
302 Ga0496105_0160121
303 Ga0496105_0418687
304 Ga0496106_0233814
305 Ga0496108_0059995
306 Ga0496109_0015927
307 Ga0496109_0751005
308 Ga0496110_0150204
309 Ga0496111_0151456
310 Ga0496112_0131096
311 Ga0496114_0060687
312 Ga0496115_0066752
313 Ga0496117_0011300
314 Ga0496118_0000424
315 Ga0496119_0108996
316 Ga0496120_0004606
317 Ga0496121_0053608
318 Ga0496124_0008303
319 Ga0496124_0025259
320 Ga0496126_0347645
321 Ga0501036_0032064
322 Ga0501047_0088567
323 Ga0501047_0352032
324 Ga0501083_0134628
325 Ga0501044_0124306
326 nmdc:mga06r32_7951_c1
327 nmdc:mga06r32_800292_c1
328 nmdc:mga0n895_123413_c1
329 nmdc:mga0n895_96452_c1
330 nmdc:mga0rr50_33387_c1
331 nmdc:mga0a205_214132_c1
332 Ga0495601_0071391
333 Ga0495612_0157434
334 Ga0495595_0067455
335 Ga0495619_0060569
336 Ga0500641_0006560
337 Ga0500616_0000273
338 Ga0501084_0075439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

8

197

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

13

265

0.84

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

10

260

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.8814 30 285
3tzc-assembly1.cif.gz_D crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae 0.8768 30 284
4wjz-assembly1.cif.gz_C crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg)(g141a) from vibrio cholerae 0.8656 30 284
3grp-assembly1.cif.gz_B 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.8656 30 285
3grp-assembly1.cif.gz_D 2.1 angstrom crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from bartonella henselae 0.8653 30 285
ID Description Score Start End Superfamily
af_A0A1D6GEP1_1_92_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8797 33 81 3.40.50.720
af_Q0JBH4_12_100_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8715 35 110 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8636 31 205 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8593 34 284 3.40.50.720
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8556 34 285 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N6XI17-F1-model_v4 deleted 0.9164 26 164
AF-A0A4R3DBH1-F1-model_v4 deleted 0.8996 33 150
AF-A0A1I5GWQ7-F1-model_v4 Short chain dehydrogenase 0.8985 34 161
AF-V9GJY1-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.8976 31 165
AF-A0A4U3AQD9-F1-model_v4 deleted 0.8879 35 162

Map