F254349

General Info

Members Datasets Scaffolds Average Seq Length
169 79 155 223

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100101001|Ga0068857_1001010011
Length 264
Sequence VEIKQNFTFKTGGNQPPVFLSTLEKNPAQLRQDQFACCKMDPMKYTTLRSIVRFIMRIIADIEVHGIEKQPSGNFIIAANHLGRLDTAVLLCVIDREDIIMAIAEKYKNHPLYGAIGRAVNGIWLNRFEADYSALRQILARMDQGGVLAIAPEGTRSKTEALQEGKMGVAFLASKSGYPILPVALTGTEDRRVVENLKHFRRLKITVTAGDWMEVHIPAGKGREQAMRAATDEIMCRIGAMLPERYRGVYADHPRLKELLETNA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
43 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
44 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
48 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
49 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
50 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
51 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
52 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
53 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
54 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
55 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
56 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
57 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
61 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
62 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
63 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
64 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
65 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
66 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
67 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
70 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
71 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
72 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
73 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
74 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
75 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
76 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
77 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
78 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
79 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.18
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3996392 2162886006 Bacteria 2120
2 SwRhRL2b_contig_204140 2162886007 Bacteria 1476
3 JGI25406J46586_10026344 3300003203 Unclassified 2243
4 rootL2_10371933 3300003322 Bacteria 1105
5 Ga0065704_10151971 3300005289 Bacteria 1415
6 Ga0065707_10000437 3300005295 Bacteria 81012
7 Ga0065707_10083849 3300005295 Bacteria 8108
8 Ga0065707_10088950 3300005295 Unclassified 4507
9 Ga0065707_10094770 3300005295 Bacteria 3455
10 Ga0070689_100548100 3300005340 Unclassified 996
11 Ga0070689_100934295 3300005340 Unclassified 769
12 Ga0070694_100244983 3300005444 Bacteria 1353
13 Ga0070694_100387191 3300005444 Bacteria 1092
14 Ga0070706_100614518 3300005467 Unclassified 1010
15 Ga0070707_100191510 3300005468 Bacteria 1994
16 Ga0070698_100115772 3300005471 Unclassified 2645
17 Ga0070698_100150282 3300005471 Bacteria 2277
18 Ga0070699_100001164 3300005518 Bacteria 24377
19 Ga0070699_100096760 3300005518 Bacteria 2585
20 Ga0070695_100030529 3300005545 Bacteria 3358
21 Ga0070696_100033567 3300005546 Bacteria 3527
22 Ga0070704_100507247 3300005549 Unclassified 1048
23 Ga0068857_100101001 3300005577 Bacteria 2588
24 Ga0068859_100064137 3300005617 Bacteria 3706
25 Ga0068859_100312608 3300005617 Bacteria 1665
26 Ga0068864_100043762 3300005618 Bacteria 3835
27 Ga0068862_100002401 3300005844 Bacteria 16663
28 Ga0068862_100017116 3300005844 Bacteria 6032
29 Ga0068862_100096287 3300005844 Unclassified 2583
30 Ga0081539_10000773 3300005985 Bacteria 62951
31 Ga0081539_10029341 3300005985 Bacteria 3438
32 Ga0075427_10004743 3300006194 Bacteria 1918
33 Ga0075428_100039942 3300006844 Bacteria 5164
34 Ga0075428_100458301 3300006844 Bacteria 1365
35 Ga0075430_100050406 3300006846 Bacteria 3511
36 Ga0075430_100580349 3300006846 Bacteria 925
37 Ga0075431_100053358 3300006847 Bacteria 4169
38 Ga0075431_100147416 3300006847 Bacteria 2425
39 Ga0075433_10442760 3300006852 Bacteria 1145
40 Ga0075429_100005322 3300006880 Bacteria 11078
41 Ga0075429_100030407 3300006880 Bacteria 4692
42 Ga0075429_100126813 3300006880 Bacteria 2232
43 Ga0097620_100064137 3300006931 Bacteria 3706
44 Ga0097620_100312586 3300006931 Bacteria 1665
45 Ga0111539_10088363 3300009094 Bacteria 3641
46 Ga0114129_10005370 3300009147 Bacteria 18085
47 Ga0114129_10043377 3300009147 Bacteria 6328
48 Ga0114129_10055217 3300009147 Bacteria 5568
49 Ga0114129_10070849 3300009147 Bacteria 4861
50 Ga0114129_10139751 3300009147 Unclassified 3321
51 Ga0114129_10545782 3300009147 Unclassified 1508
52 Ga0114129_11143847 3300009147 Bacteria 972
53 Ga0105243_10007927 3300009148 Bacteria 8154
54 Ga0105243_10043272 3300009148 Bacteria 3529
55 Ga0105242_10042540 3300009176 Unclassified 3669
56 Ga0105249_10033582 3300009553 Bacteria 4646
57 Ga0105246_10079153 3300011119 Bacteria 2336
58 Ga0157379_10229355 3300014968 Bacteria 1683
59 Ga0207646_10175982 3300025922 Bacteria 1933
60 Ga0207670_10046558 3300025936 Bacteria 2883
61 Ga0207712_10040309 3300025961 Bacteria 3204
62 Ga0207703_10646514 3300026035 Unclassified 1003
63 Ga0207675_100264639 3300026118 Bacteria 1667
64 Ga0268265_10056565 3300028380 Bacteria 2985
65 Ga0268265_10354557 3300028380 Bacteria 1341
66 Ga0268264_11133833 3300028381 Unclassified 791
67 Ga0307408_100241515 3300031548 Bacteria 1485
68 Ga0316575_10066325 3300031665 Bacteria 1446
69 Ga0316576_10024516 3300031727 Unclassified 4213
70 Ga0307412_10150001 3300031911 Bacteria 1719
71 Ga0307416_100270569 3300032002 Bacteria 1668
72 Ga0307416_100326121 3300032002 Bacteria 1540
73 Ga0307411_10598895 3300032005 Unclassified 947
74 Ga0373949_0012846 3300035090 Unclassified 1855
75 Ga0400484_03789 3300038725 Unclassified 1024
76 Ga0451577_0041038 3300042876 Unclassified 4155
77 Ga0451577_0066315 3300042876 Bacteria 3220
78 Ga0451577_0078971 3300042876 Unclassified 2934
79 Ga0451577_0216444 3300042876 Unclassified 1731
80 Ga0451577_0556789 3300042876 Unclassified 1041
81 Ga0451577_0724356 3300042876 Bacteria 900
82 Ga0453683_0004625 3300044673 Bacteria 9722
83 Ga0453683_0014186 3300044673 Bacteria 5179
84 Ga0453683_0021918 3300044673 Unclassified 4076
85 Ga0453683_0077042 3300044673 Unclassified 2088
86 Ga0453683_0141896 3300044673 Bacteria 1516
87 Ga0453684_0000802 3300044712 Bacteria 107142
88 Ga0453684_0005577 3300044712 Bacteria 24799
89 Ga0453684_0008063 3300044712 Bacteria 19044
90 Ga0453684_0070327 3300044712 Bacteria 4432
91 Ga0453684_0078468 3300044712 Bacteria 4132
92 Ga0453684_0139061 3300044712 Bacteria 2903
93 Ga0453684_0202646 3300044712 Unclassified 2312
94 Ga0453684_0254662 3300044712 Bacteria 2014
95 Ga0453684_0322091 3300044712 Unclassified 1750
96 Ga0453684_0329765 3300044712 Bacteria 1726
97 Ga0453684_0428313 3300044712 Bacteria 1476
98 Ga0453684_0517684 3300044712 Bacteria 1318
99 Ga0453684_0885338 3300044712 Bacteria 957
100 Ga0453684_1338420 3300044712 Bacteria 745
101 Ga0451576_0003446 3300045051 Bacteria 21709
102 Ga0451576_0010065 3300045051 Bacteria 10887
103 Ga0451576_0339105 3300045051 Bacteria 1573
104 Ga0451576_0462681 3300045051 Bacteria 1332
105 Ga0451576_0807927 3300045051 Bacteria 985
106 Ga0496108_0222093 3300048911 Bacteria 1642
107 Ga0501038_0218409 3300049574 Bacteria 1522
108 Ga0501039_0149862 3300049575 Bacteria 1833
109 Ga0501039_0536444 3300049575 Unclassified 918
110 Ga0501040_0151512 3300049576 Unclassified 1636
111 Ga0501041_0316113 3300049577 Unclassified 985
112 Ga0501048_0503554 3300049582 Unclassified 868
113 Ga0501068_0088731 3300049584 Bacteria 1905
114 Ga0501071_0260276 3300049587 Unclassified 1310
115 Ga0501071_0269685 3300049587 Unclassified 1287
116 Ga0501072_0161903 3300049588 Bacteria 1785
117 Ga0501073_0010436 3300049589 Bacteria 6810
118 Ga0501073_0418461 3300049589 Bacteria 926
119 Ga0501073_0461095 3300049589 Unclassified 878
120 Ga0501075_0115478 3300049591 Bacteria 2041
121 Ga0501075_0294597 3300049591 Unclassified 1236
122 Ga0501075_0609320 3300049591 Unclassified 833
123 Ga0501076_0064888 3300049592 Unclassified 2911
124 Ga0501076_0107854 3300049592 Bacteria 2249
125 Ga0501076_0162307 3300049592 Unclassified 1821
126 Ga0501076_0668438 3300049592 Unclassified 857
127 Ga0501077_0284064 3300049593 Bacteria 1053
128 Ga0501079_0486956 3300049741 Unclassified 969
129 Ga0501079_0800393 3300049741 Unclassified 742
130 Ga0501080_0004764 3300049742 Bacteria 12102
131 Ga0501080_0209006 3300049742 Unclassified 1789
132 Ga0501081_0437848 3300049743 Unclassified 970
133 Ga0501045_0265605 3300049824 Unclassified 1278
134 nmdc:mga05p37_100359_c1 3300050507 Bacteria 3565
135 nmdc:mga05p37_127394_c1 3300050507 Bacteria 3126
136 nmdc:mga05p37_4771_c1 3300050507 Bacteria 14911
137 nmdc:mga05p37_5697_c1 3300050507 Bacteria 14643
138 nmdc:mga05p37_63819_c1 3300050507 Bacteria 4533
139 nmdc:mga09592_318821_c1 3300050508 Unclassified 1347
140 nmdc:mga09592_436897_c1 3300050508 Bacteria 1130
141 nmdc:mga09592_5143_c1 3300050508 Bacteria 10624
142 nmdc:mga0qj67_20938_c1 3300050509 Bacteria 5011
143 nmdc:mga0qj67_504725_c1 3300050509 Bacteria 972
144 nmdc:mga06r32_140031_c1 3300050510 Bacteria 2395
145 nmdc:mga0n895_579144_c1 3300050512 Bacteria 1126
146 nmdc:mga0a205_369807_c1 3300050515 Bacteria 1299
147 nmdc:mga0a205_427259_c1 3300050515 Bacteria 1186
148 nmdc:mga0a205_759829_c1 3300050515 Unclassified 818
149 nmdc:mga0a205_945324_c1 3300050515 Bacteria 709
150 Ga0501084_0000183 3300054114 Bacteria 48760
151 Ga0501084_0190324 3300054114 Bacteria 1731
152 Ga0501084_0430625 3300054114 Unclassified 1115
153 Ga0501082_0423023 3300060353 Bacteria 1163
154 Ga0501082_0589171 3300060353 Unclassified 973
155 Ga0530510_0108210 3300061734 Unclassified 2035

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0807927 Ga0451576_0807927_30_656 207
2 3300049741 Ga0501079_0800393 Ga0501079_0800393_32_676 214
3 3300044712 Ga0453684_0885338 Ga0453684_0885338_36_701 216
4 3300005340 Ga0070689_100548100 Ga0070689_1005481002 219
5 3300005518 Ga0070699_100001164 Ga0070699_1000011641 219
6 3300005617 Ga0068859_100312608 Ga0068859_1003126082 219
7 3300005844 Ga0068862_100017116 Ga0068862_1000171164 219
8 3300006194 Ga0075427_10004743 Ga0075427_100047431 219
9 3300006846 Ga0075430_100580349 Ga0075430_1005803492 219
10 3300006852 Ga0075433_10442760 Ga0075433_104427601 219
11 3300006880 Ga0075429_100005322 Ga0075429_1000053226 219
12 3300006931 Ga0097620_100312586 Ga0097620_1003125862 219
13 3300009147 Ga0114129_10070849 Ga0114129_100708493 219
14 3300009553 Ga0105249_10033582 Ga0105249_100335823 219
15 3300025961 Ga0207712_10040309 Ga0207712_100403092 219
16 3300028380 Ga0268265_10056565 Ga0268265_100565654 219
17 3300031727 Ga0316576_10024516 Ga0316576_100245164 219
18 3300044673 Ga0453683_0141896 Ga0453683_0141896_617_1279 219
19 3300050507 nmdc:mga05p37_63819_c1 nmdc:mga05p37_63819_c1_1070_1732 219
20 3300050508 nmdc:mga09592_5143_c1 nmdc:mga09592_5143_c1_2947_3609 219
21 3300050512 nmdc:mga0n895_579144_c1 nmdc:mga0n895_579144_c1_382_1044 219
22 3300050515 nmdc:mga0a205_369807_c1 nmdc:mga0a205_369807_c1_431_1093 219
23 3300050515 nmdc:mga0a205_945324_c1 nmdc:mga0a205_945324_c1_14_676 219
24 3300005289 Ga0065704_10151971 Ga0065704_101519712 220
25 3300005295 Ga0065707_10083849 Ga0065707_100838498 220
26 3300005295 Ga0065707_10088950 Ga0065707_100889502 220
27 3300005471 Ga0070698_100150282 Ga0070698_1001502822 220
28 3300005617 Ga0068859_100064137 Ga0068859_1000641374 220
29 3300005618 Ga0068864_100043762 Ga0068864_1000437624 220
30 3300005844 Ga0068862_100002401 Ga0068862_1000024017 220
31 3300005985 Ga0081539_10029341 Ga0081539_100293413 220
32 3300006846 Ga0075430_100050406 Ga0075430_1000504063 220
33 3300006847 Ga0075431_100053358 Ga0075431_1000533583 220
34 3300006880 Ga0075429_100030407 Ga0075429_1000304075 220
35 3300006880 Ga0075429_100126813 Ga0075429_1001268133 220
36 3300006931 Ga0097620_100064137 Ga0097620_1000641372 220
37 3300009147 Ga0114129_10545782 Ga0114129_105457821 220
38 3300009147 Ga0114129_11143847 Ga0114129_111438472 220
39 3300025936 Ga0207670_10046558 Ga0207670_100465583 220
40 3300031665 Ga0316575_10066325 Ga0316575_100663252 220
41 3300032002 Ga0307416_100270569 Ga0307416_1002705692 220
42 3300042876 Ga0451577_0066315 Ga0451577_0066315_251_913 220
43 3300044712 Ga0453684_0254662 Ga0453684_0254662_564_1226 220
44 3300044712 Ga0453684_0428313 Ga0453684_0428313_305_967 220
45 3300045051 Ga0451576_0003446 Ga0451576_0003446_20225_20887 220
46 3300049574 Ga0501038_0218409 Ga0501038_0218409_479_1144 220
47 3300049577 Ga0501041_0316113 Ga0501041_0316113_190_852 220
48 3300049584 Ga0501068_0088731 Ga0501068_0088731_697_1362 220
49 3300049589 Ga0501073_0010436 Ga0501073_0010436_1006_1680 220
50 3300049589 Ga0501073_0418461 Ga0501073_0418461_203_877 220
51 3300049589 Ga0501073_0461095 Ga0501073_0461095_22_687 220
52 3300049591 Ga0501075_0294597 Ga0501075_0294597_355_1017 220
53 3300049592 Ga0501076_0064888 Ga0501076_0064888_1727_2389 220
54 3300049592 Ga0501076_0668438 Ga0501076_0668438_138_800 220
55 3300049593 Ga0501077_0284064 Ga0501077_0284064_97_759 220
56 3300049742 Ga0501080_0004764 Ga0501080_0004764_9356_10021 220
57 3300049824 Ga0501045_0265605 Ga0501045_0265605_235_897 220
58 3300050507 nmdc:mga05p37_127394_c1 nmdc:mga05p37_127394_c1_368_1030 220
59 3300050508 nmdc:mga09592_318821_c1 nmdc:mga09592_318821_c1_200_862 220
60 3300050509 nmdc:mga0qj67_504725_c1 nmdc:mga0qj67_504725_c1_286_948 220
61 3300050510 nmdc:mga06r32_140031_c1 nmdc:mga06r32_140031_c1_506_1168 220
62 3300054114 Ga0501084_0000183 Ga0501084_0000183_42532_43206 220
63 3300054114 Ga0501084_0430625 Ga0501084_0430625_292_954 220
64 3300060353 Ga0501082_0423023 Ga0501082_0423023_454_1116 220
65 3300060353 Ga0501082_0589171 Ga0501082_0589171_166_828 220
66 3300003203 JGI25406J46586_10026344 JGI25406J46586_100263443 221
67 3300005295 Ga0065707_10094770 Ga0065707_100947702 221
68 3300005549 Ga0070704_100507247 Ga0070704_1005072472 221
69 3300005844 Ga0068862_100017116 Ga0068862_1000171163 221
70 3300005985 Ga0081539_10000773 Ga0081539_1000077360 221
71 3300006844 Ga0075428_100039942 Ga0075428_1000399423 221
72 3300006846 Ga0075430_100050406 Ga0075430_1000504062 221
73 3300006847 Ga0075431_100053358 Ga0075431_1000533582 221
74 3300006880 Ga0075429_100030407 Ga0075429_1000304074 221
75 3300009147 Ga0114129_10055217 Ga0114129_100552176 221
76 3300009147 Ga0114129_10139751 Ga0114129_101397513 221
77 3300009553 Ga0105249_10033582 Ga0105249_100335824 221
78 3300026035 Ga0207703_10646514 Ga0207703_106465142 221
79 3300028380 Ga0268265_10056565 Ga0268265_100565653 221
80 3300031727 Ga0316576_10024516 Ga0316576_100245163 221
81 3300042876 Ga0451577_0216444 Ga0451577_0216444_709_1374 221
82 3300042876 Ga0451577_0556789 Ga0451577_0556789_219_893 221
83 3300044712 Ga0453684_0000802 Ga0453684_0000802_24208_24873 221
84 3300044712 Ga0453684_0202646 Ga0453684_0202646_274_939 221
85 3300044712 Ga0453684_0322091 Ga0453684_0322091_478_1152 221
86 3300045051 Ga0451576_0462681 Ga0451576_0462681_153_866 221
87 3300048911 Ga0496108_0222093 Ga0496108_0222093_767_1480 221
88 3300049575 Ga0501039_0149862 Ga0501039_0149862_391_1092 221
89 3300049582 Ga0501048_0503554 Ga0501048_0503554_121_822 221
90 3300049587 Ga0501071_0269685 Ga0501071_0269685_569_1270 221
91 3300049588 Ga0501072_0161903 Ga0501072_0161903_246_947 221
92 3300049743 Ga0501081_0437848 Ga0501081_0437848_31_732 221
93 3300050507 nmdc:mga05p37_100359_c1 nmdc:mga05p37_100359_c1_1793_2458 221
94 3300050507 nmdc:mga05p37_63819_c1 nmdc:mga05p37_63819_c1_402_1067 221
95 3300050508 nmdc:mga09592_436897_c1 nmdc:mga09592_436897_c1_240_905 221
96 3300050508 nmdc:mga09592_5143_c1 nmdc:mga09592_5143_c1_2279_2944 221
97 3300050509 nmdc:mga0qj67_20938_c1 nmdc:mga0qj67_20938_c1_3962_4636 221
98 3300050510 nmdc:mga06r32_140031_c1 nmdc:mga06r32_140031_c1_1174_1848 221
99 2162886006 SwRhRL3b_contig_3996392 SwRhRL3b_0385.00003080 222
100 2162886007 SwRhRL2b_contig_204140 SwRhRL2b_0080.00008650 222
101 3300003322 rootL2_10371933 rootL2_103719332 222
102 3300005295 Ga0065707_10000437 Ga0065707_1000043729 222
103 3300005340 Ga0070689_100934295 Ga0070689_1009342951 222
104 3300005444 Ga0070694_100244983 Ga0070694_1002449832 222
105 3300005444 Ga0070694_100387191 Ga0070694_1003871911 222
106 3300005467 Ga0070706_100614518 Ga0070706_1006145182 222
107 3300005468 Ga0070707_100191510 Ga0070707_1001915103 222
108 3300005471 Ga0070698_100115772 Ga0070698_1001157724 222
109 3300005518 Ga0070699_100096760 Ga0070699_1000967601 222
110 3300005545 Ga0070695_100030529 Ga0070695_1000305292 222
111 3300005546 Ga0070696_100033567 Ga0070696_1000335674 222
112 3300005577 Ga0068857_100101001 Ga0068857_1001010011 222
113 3300005844 Ga0068862_100096287 Ga0068862_1000962872 222
114 3300005985 Ga0081539_10000773 Ga0081539_1000077359 222
115 3300006844 Ga0075428_100458301 Ga0075428_1004583012 222
116 3300006847 Ga0075431_100147416 Ga0075431_1001474164 222
117 3300009094 Ga0111539_10088363 Ga0111539_100883634 222
118 3300009147 Ga0114129_10005370 Ga0114129_1000537013 222
119 3300009147 Ga0114129_10043377 Ga0114129_100433775 222
120 3300009147 Ga0114129_10139751 Ga0114129_101397514 222
121 3300009148 Ga0105243_10007927 Ga0105243_100079276 222
122 3300009148 Ga0105243_10043272 Ga0105243_100432721 222
123 3300009176 Ga0105242_10042540 Ga0105242_100425403 222
124 3300011119 Ga0105246_10079153 Ga0105246_100791533 222
125 3300014968 Ga0157379_10229355 Ga0157379_102293552 222
126 3300025922 Ga0207646_10175982 Ga0207646_101759823 222
127 3300026118 Ga0207675_100264639 Ga0207675_1002646391 222
128 3300028380 Ga0268265_10354557 Ga0268265_103545572 222
129 3300028381 Ga0268264_11133833 Ga0268264_111338331 222
130 3300031548 Ga0307408_100241515 Ga0307408_1002415153 222
131 3300031911 Ga0307412_10150001 Ga0307412_101500012 222
132 3300032002 Ga0307416_100326121 Ga0307416_1003261212 222
133 3300032005 Ga0307411_10598895 Ga0307411_105988952 222
134 3300035090 Ga0373949_0012846 Ga0373949_0012846_179_847 222
135 3300038725 Ga0400484_03789 Ga0400484_03789_182_859 222
136 3300042876 Ga0451577_0041038 Ga0451577_0041038_2403_3104 222
137 3300042876 Ga0451577_0078971 Ga0451577_0078971_1158_1826 222
138 3300042876 Ga0451577_0724356 Ga0451577_0724356_110_781 222
139 3300044673 Ga0453683_0004625 Ga0453683_0004625_1796_2464 222
140 3300044673 Ga0453683_0014186 Ga0453683_0014186_2352_3020 222
141 3300044673 Ga0453683_0021918 Ga0453683_0021918_1957_2634 222
142 3300044673 Ga0453683_0077042 Ga0453683_0077042_865_1533 222
143 3300044712 Ga0453684_0005577 Ga0453684_0005577_765_1442 222
144 3300044712 Ga0453684_0008063 Ga0453684_0008063_13357_14034 222
145 3300044712 Ga0453684_0070327 Ga0453684_0070327_969_1643 222
146 3300044712 Ga0453684_0078468 Ga0453684_0078468_2456_3124 222
147 3300044712 Ga0453684_0139061 Ga0453684_0139061_674_1342 222
148 3300044712 Ga0453684_0329765 Ga0453684_0329765_45_716 222
149 3300044712 Ga0453684_0517684 Ga0453684_0517684_622_1299 222
150 3300044712 Ga0453684_1338420 Ga0453684_1338420_19_687 222
151 3300045051 Ga0451576_0010065 Ga0451576_0010065_7488_8156 222
152 3300045051 Ga0451576_0339105 Ga0451576_0339105_138_806 222
153 3300048911 Ga0496108_0222093 Ga0496108_0222093_106_774 222
154 3300049575 Ga0501039_0536444 Ga0501039_0536444_162_830 222
155 3300049576 Ga0501040_0151512 Ga0501040_0151512_97_765 222
156 3300049587 Ga0501071_0260276 Ga0501071_0260276_560_1228 222
157 3300049591 Ga0501075_0115478 Ga0501075_0115478_1273_1941 222
158 3300049591 Ga0501075_0609320 Ga0501075_0609320_31_801 222
159 3300049592 Ga0501076_0107854 Ga0501076_0107854_845_1513 222
160 3300049592 Ga0501076_0162307 Ga0501076_0162307_470_1228 222
161 3300049741 Ga0501079_0486956 Ga0501079_0486956_183_851 222
162 3300049742 Ga0501080_0209006 Ga0501080_0209006_677_1345 222
163 3300050507 nmdc:mga05p37_100359_c1 nmdc:mga05p37_100359_c1_1122_1796 222
164 3300050507 nmdc:mga05p37_4771_c1 nmdc:mga05p37_4771_c1_4853_5521 222
165 3300050507 nmdc:mga05p37_5697_c1 nmdc:mga05p37_5697_c1_13440_14108 222
166 3300050515 nmdc:mga0a205_427259_c1 nmdc:mga0a205_427259_c1_76_744 222
167 3300050515 nmdc:mga0a205_759829_c1 nmdc:mga0a205_759829_c1_18_686 222
168 3300054114 Ga0501084_0190324 Ga0501084_0190324_280_948 222
169 3300061734 Ga0530510_0108210 Ga0530510_0108210_1109_1777 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

61

186

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7546 3 192
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7481 3 192
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6285 4 198
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.625 3 192
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6129 3 192
ID Description Score Start End Superfamily
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8947 19 142 3.40.50.2000
af_O53516_20_152_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8774 21 142 3.40.50.2000
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8772 19 142 3.40.50.2000
af_O07809_23_150_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.877 23 142 3.40.50.2000
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8768 21 142 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A3M0X535-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9631 1 196 GO:0003841
GO:0006654
AF-A0A363TAF9-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9575 1 221 GO:0003841
GO:0006654
AF-A0A363TAF9-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.9491 1 221 GO:0003841
GO:0006654
AF-A0A3M0X535-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.949 1 196 GO:0003841
GO:0006654
AF-A0A523U146-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9415 3 210 GO:0003841
GO:0006654

Feature Viewer

pLDDT pTM Quality
92.75 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map