F253728

General Info

Members Datasets Scaffolds Average Seq Length
168 139 336 180

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990710928|2990712661
Length 197
Sequence APLNADAHEAAWGHALFDTALGPCGIAWGPGGIAAVQLPEADAPATQARLLRGLRQGTYPQVLPPAVPPAVVRHAIAGIQGLLAGQALDLREVPLDMSGVSAFHQQVYAIARAIPPGQTRTYGEVAEQMGGKGLSRAVGQALGLNPFAPVVPCHRVLAAGDKPGGFSAGGGALTKMRMLEIEGACLGGTRSLFGSAD

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
15 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
24 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
27 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
28 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
29 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
32 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
50 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
68 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
69 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
70 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
71 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
72 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
73 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
74 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
75 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
76 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
79 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
80 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
81 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
82 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
85 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
98 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
103 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
129 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
130 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
131 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
132 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
133 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
134 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
135 2643221596 Acidovorax sp. Root70 Isolate Unclassified
136 2842733646 Variovorax sp. R-72446 Isolate Unclassified
137 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
138 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
139 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0.6
Isolates 3.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0.6
Rhizoplane 7.74
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000304 3300003187 Bacteria 53759
2 rootL2_10256485 3300003322 Bacteria 1672
3 Ga0055534_1013024 3300003784 Bacteria 1615
4 Ga0070658_10783908 3300005327 Bacteria 828
5 Ga0070682_100085782 3300005337 Bacteria 2049
6 Ga0070671_100026961 3300005355 Bacteria 4726
7 Ga0070674_100089688 3300005356 Bacteria 2216
8 Ga0070674_100408634 3300005356 Bacteria 1111
9 Ga0070678_100180538 3300005456 Bacteria 1727
10 Ga0068867_100155016 3300005459 Bacteria 1802
11 Ga0068855_100100214 3300005563 Bacteria 3336
12 Ga0068857_100206627 3300005577 Bacteria 1791
13 Ga0068863_100464573 3300005841 Bacteria 1243
14 Ga0070717_10009625 3300006028 Bacteria 7272
15 Ga0075369_10061385 3300006186 Bacteria 1641
16 Ga0075366_10010395 3300006195 Bacteria 5225
17 Ga0075370_10007401 3300006353 Bacteria 5590
18 Ga0075428_101207403 3300006844 Bacteria 797
19 Ga0075430_100090416 3300006846 Bacteria 2561
20 Ga0075429_100105266 3300006880 Bacteria 2464
21 Ga0105240_10946043 3300009093 Bacteria 924
22 Ga0105238_10285497 3300009551 Bacteria 1632
23 Ga0157378_10210821 3300013297 Bacteria 1842
24 Ga0163162_10098128 3300013306 Bacteria 3019
25 Ga0157380_10900557 3300014326 Bacteria 911
26 Ga0182008_10001036 3300014497 Bacteria 19328
27 Ga0182008_10284675 3300014497 Bacteria 861
28 Ga0182007_10003620 3300015262 Bacteria 7248
29 Ga0182007_10235430 3300015262 Bacteria 652
30 Ga0182005_1011875 3300015265 Bacteria 2471
31 Ga0183362_10001 3300015683 Bacteria 2046624
32 Ga0163161_10065874 3300017792 Bacteria 2644
33 Ga0213872_10046850 3300021361 Bacteria 1967
34 Ga0209129_1000873 3300025258 Bacteria 18565
35 Ga0209673_1012419 3300025273 Bacteria 3431
36 Ga0209130_1006844 3300025284 Bacteria 3628
37 Ga0209675_1013272 3300025291 Bacteria 2591
38 Ga0209676_1010820 3300025292 Bacteria 3750
39 Ga0209025_1000446 3300025294 Bacteria 80985
40 Ga0209051_1011332 3300025303 Bacteria 4408
41 Ga0209257_1059859 3300025304 Bacteria 1038
42 Ga0207682_10332528 3300025893 Bacteria 714
43 Ga0207688_10141601 3300025901 Bacteria 1416
44 Ga0207681_10563971 3300025923 Bacteria 938
45 Ga0207709_10016284 3300025935 Bacteria 4131
46 Ga0207667_10623886 3300025949 Bacteria 1085
47 Ga0207651_11318237 3300025960 Bacteria 649
48 Ga0207678_10270862 3300026067 Bacteria 1456
49 Ga0207674_10182177 3300026116 Bacteria 2052
50 Ga0207683_10088685 3300026121 Bacteria 2753
51 Ga0307515_10000137 3300028794 Bacteria 173516
52 Ga0265327_10023650 3300031251 Bacteria 3634
53 Ga0307513_10000017 3300031456 Bacteria 282386
54 Ga0307513_10217921 3300031456 Bacteria 1732
55 Ga0307408_100787697 3300031548 Bacteria 862
56 Ga0307508_10685532 3300031616 Bacteria 633
57 Ga0307516_10068381 3300031730 Bacteria 3421
58 Ga0307406_10003122 3300031901 Bacteria 9007
59 Ga0307412_10373114 3300031911 Bacteria 1153
60 Ga0307412_10794015 3300031911 Bacteria 821
61 Ga0373923_0060752 3300035111 Bacteria 1605
62 Ga0395899_0001240 3300037312 Bacteria 22229
63 Ga0395899_0063854 3300037312 Bacteria 2708
64 Ga0395900_0074670 3300037418 Bacteria 3485
65 Ga0395900_0116309 3300037418 Bacteria 2744
66 Ga0395900_0404163 3300037418 Unclassified 1329
67 Ga0395900_0416395 3300037418 Bacteria 1305
68 Ga0395898_0006153 3300037466 Bacteria 12851
69 Ga0395898_0011839 3300037466 Bacteria 9037
70 Ga0395898_0033566 3300037466 Bacteria 5120
71 Ga0395905_0000148 3300037471 Bacteria 116301
72 Ga0395905_0000443 3300037471 Bacteria 58027
73 Ga0395905_0031411 3300037471 Bacteria 4999
74 Ga0395905_0032764 3300037471 Bacteria 4885
75 Ga0395905_0076898 3300037471 Bacteria 3127
76 Ga0395905_0093761 3300037471 Bacteria 2816
77 Ga0395905_0725193 3300037471 Bacteria 896
78 Ga0395901_0048548 3300038443 Bacteria 4408
79 Ga0395901_0130781 3300038443 Bacteria 2637
80 Ga0395901_0145302 3300038443 Bacteria 2493
81 Ga0395901_0238811 3300038443 Bacteria 1896
82 Ga0436365_1547074 3300039437 Bacteria 4256
83 Ga0436360_0088701 3300039438 Bacteria 850
84 Ga0436361_1207570 3300039447 Bacteria 2036
85 Ga0439436_0000101 3300041404 Bacteria 20278
86 Ga0439439_0005173 3300041406 Bacteria 2970
87 Ga0439447_036870 3300041407 Bacteria 1206
88 Ga0439461_0008058 3300041410 Bacteria 1882
89 Ga0439466_0002313 3300041411 Bacteria 7479
90 Ga0439465_0000076 3300041413 Bacteria 21471
91 Ga0439465_0138589 3300041413 Bacteria 863
92 Ga0439431_0001819 3300041997 Bacteria 4720
93 Ga0439431_0007325 3300041997 Bacteria 2459
94 Ga0439442_008594 3300042002 Bacteria 2061
95 Ga0439445_0016878 3300042004 Bacteria 1800
96 Ga0439432_002217 3300042006 Bacteria 7332
97 Ga0439449_0000104 3300042007 Bacteria 27274
98 Ga0439452_001665 3300042010 Bacteria 8759
99 Ga0439457_003271 3300042014 Bacteria 4437
100 Ga0439462_0010458 3300042015 Bacteria 2349
101 Ga0450888_010012 3300042126 Bacteria 1092
102 Ga0450898_010082 3300042134 Bacteria 1524
103 Ga0439446_0010082 3300042156 Bacteria 2539
104 Ga0450909_002915 3300042185 Bacteria 2429
105 Ga0439434_0052788 3300042435 Bacteria 1262
106 Ga0439444_0049408 3300042437 Bacteria 850
107 Ga0450893_0001473 3300042532 Bacteria 3613
108 Ga0466969_0125510 3300044656 Bacteria 1192
109 Ga0466972_0193854 3300044658 Bacteria 952
110 Ga0466965_0004429 3300044683 Bacteria 6247
111 Ga0466961_0250198 3300044693 Bacteria 1088
112 Ga0466971_0272675 3300044719 Bacteria 809
113 Ga0466968_0235486 3300044735 Bacteria 866
114 Ga0466957_0029185 3300044842 Bacteria 3288
115 Ga0466957_0639128 3300044842 Bacteria 747
116 Ga0466959_0142548 3300045049 Bacteria 1692
117 Ga0451576_0616937 3300045051 Bacteria 1140
118 Ga0495592_0350578 3300046454 Bacteria 946
119 Ga0495653_0381014 3300046463 Bacteria 901
120 Ga0495639_0001935 3300046475 Bacteria 9192
121 Ga0495584_0633809 3300046491 Bacteria 545
122 Ga0495643_0088177 3300046522 Bacteria 1604
123 Ga0495663_0086288 3300046525 Bacteria 1017
124 Ga0495642_0077648 3300046528 Bacteria 1395
125 Ga0495621_0058087 3300046539 Bacteria 1398
126 Ga0495633_0206841 3300046558 Bacteria 900
127 Ga0495656_0000051 3300046615 Bacteria 55112
128 Ga0495661_0194845 3300046665 Bacteria 1065
129 Ga0495588_0075726 3300046674 Bacteria 1753
130 Ga0495613_0582122 3300046689 Bacteria 746
131 Ga0495680_0426708 3300047322 Bacteria 911
132 Ga0495615_0030155 3300048090 Bacteria 1292
133 Ga0496101_0503814 3300048904 Bacteria 956
134 Ga0496102_0056337 3300048905 Bacteria 3586
135 Ga0496102_0895566 3300048905 Bacteria 809
136 Ga0496104_0011577 3300048907 Bacteria 7905
137 Ga0496107_0017025 3300048910 Bacteria 5111
138 Ga0496108_0824909 3300048911 Bacteria 799
139 Ga0496109_0302701 3300048912 Bacteria 1508
140 Ga0496109_0530915 3300048912 Bacteria 1110
141 Ga0496110_0029664 3300048913 Bacteria 4710
142 Ga0496111_0859084 3300048914 Bacteria 655
143 Ga0496113_0426118 3300048916 Bacteria 1066
144 Ga0496114_0180141 3300048917 Bacteria 1845
145 Ga0496114_0485094 3300048917 Bacteria 1093
146 Ga0501305_007550 3300049161 Bacteria 1384
147 Ga0501032_0126625 3300049569 Bacteria 1687
148 Ga0501033_0000406 3300049570 Bacteria 41259
149 Ga0501033_0265127 3300049570 Bacteria 1215
150 Ga0501043_0027286 3300049579 Bacteria 4484
151 Ga0501047_0593921 3300049581 Bacteria 929
152 Ga0501035_0001005 3300049822 Bacteria 29797
153 Ga0501044_0548718 3300049823 Bacteria 1053
154 Ga0501044_0780201 3300049823 Bacteria 836
155 nmdc:mga03n38_691699_c1 3300050490 Bacteria 587
156 nmdc:mga0yw44_573538_c1 3300050492 Bacteria 766
157 nmdc:mga0k408_232311_c1 3300050493 Bacteria 1101
158 nmdc:mga0k408_33408_c1 3300050493 Bacteria 2942
159 nmdc:mga07m45_2281_c1 3300050496 Bacteria 8962
160 nmdc:mga09592_169069_c1 3300050508 Bacteria 1890
161 Ga0500636_0111011 3300053177 Bacteria 1549
162 Ga0500552_047090 3300053733 Bacteria 720
163 2990712661 2990710928 Bacteria 5002431
164 2643993425 2643221596 Bacteria 5006805
165 2842734979 2842733646 Bacteria 5716726
166 2885192533 2885192300 Bacteria 5882526
167 2894025939 2894023352 Bacteria 5167372
168 2919707502 2919704043 Bacteria 5560311
169 JGI25151J46595_10000304
170 rootL2_10256485
171 Ga0055534_1013024
172 Ga0070658_10783908
173 Ga0070682_100085782
174 Ga0070671_100026961
175 Ga0070674_100089688
176 Ga0070674_100408634
177 Ga0070678_100180538
178 Ga0068867_100155016
179 Ga0068855_100100214
180 Ga0068857_100206627
181 Ga0068863_100464573
182 Ga0070717_10009625
183 Ga0075369_10061385
184 Ga0075366_10010395
185 Ga0075370_10007401
186 Ga0075428_101207403
187 Ga0075430_100090416
188 Ga0075429_100105266
189 Ga0105240_10946043
190 Ga0105238_10285497
191 Ga0157378_10210821
192 Ga0163162_10098128
193 Ga0157380_10900557
194 Ga0182008_10001036
195 Ga0182008_10284675
196 Ga0182007_10003620
197 Ga0182007_10235430
198 Ga0182005_1011875
199 Ga0183362_10001
200 Ga0163161_10065874
201 Ga0213872_10046850
202 Ga0209129_1000873
203 Ga0209673_1012419
204 Ga0209130_1006844
205 Ga0209675_1013272
206 Ga0209676_1010820
207 Ga0209025_1000446
208 Ga0209051_1011332
209 Ga0209257_1059859
210 Ga0207682_10332528
211 Ga0207688_10141601
212 Ga0207681_10563971
213 Ga0207709_10016284
214 Ga0207667_10623886
215 Ga0207651_11318237
216 Ga0207678_10270862
217 Ga0207674_10182177
218 Ga0207683_10088685
219 Ga0307515_10000137
220 Ga0265327_10023650
221 Ga0307513_10000017
222 Ga0307513_10217921
223 Ga0307408_100787697
224 Ga0307508_10685532
225 Ga0307516_10068381
226 Ga0307406_10003122
227 Ga0307412_10373114
228 Ga0307412_10794015
229 Ga0373923_0060752
230 Ga0395899_0001240
231 Ga0395899_0063854
232 Ga0395900_0074670
233 Ga0395900_0116309
234 Ga0395900_0404163
235 Ga0395900_0416395
236 Ga0395898_0006153
237 Ga0395898_0011839
238 Ga0395898_0033566
239 Ga0395905_0000148
240 Ga0395905_0000443
241 Ga0395905_0031411
242 Ga0395905_0032764
243 Ga0395905_0076898
244 Ga0395905_0093761
245 Ga0395905_0725193
246 Ga0395901_0048548
247 Ga0395901_0130781
248 Ga0395901_0145302
249 Ga0395901_0238811
250 Ga0436365_1547074
251 Ga0436360_0088701
252 Ga0436361_1207570
253 Ga0439436_0000101
254 Ga0439439_0005173
255 Ga0439447_036870
256 Ga0439461_0008058
257 Ga0439466_0002313
258 Ga0439465_0000076
259 Ga0439465_0138589
260 Ga0439431_0001819
261 Ga0439431_0007325
262 Ga0439442_008594
263 Ga0439445_0016878
264 Ga0439432_002217
265 Ga0439449_0000104
266 Ga0439452_001665
267 Ga0439457_003271
268 Ga0439462_0010458
269 Ga0450888_010012
270 Ga0450898_010082
271 Ga0439446_0010082
272 Ga0450909_002915
273 Ga0439434_0052788
274 Ga0439444_0049408
275 Ga0450893_0001473
276 Ga0466969_0125510
277 Ga0466972_0193854
278 Ga0466965_0004429
279 Ga0466961_0250198
280 Ga0466971_0272675
281 Ga0466968_0235486
282 Ga0466957_0029185
283 Ga0466957_0639128
284 Ga0466959_0142548
285 Ga0451576_0616937
286 Ga0495592_0350578
287 Ga0495653_0381014
288 Ga0495639_0001935
289 Ga0495584_0633809
290 Ga0495643_0088177
291 Ga0495663_0086288
292 Ga0495642_0077648
293 Ga0495621_0058087
294 Ga0495633_0206841
295 Ga0495656_0000051
296 Ga0495661_0194845
297 Ga0495588_0075726
298 Ga0495613_0582122
299 Ga0495680_0426708
300 Ga0495615_0030155
301 Ga0496101_0503814
302 Ga0496102_0056337
303 Ga0496102_0895566
304 Ga0496104_0011577
305 Ga0496107_0017025
306 Ga0496108_0824909
307 Ga0496109_0302701
308 Ga0496109_0530915
309 Ga0496110_0029664
310 Ga0496111_0859084
311 Ga0496113_0426118
312 Ga0496114_0180141
313 Ga0496114_0485094
314 Ga0501305_007550
315 Ga0501032_0126625
316 Ga0501033_0000406
317 Ga0501033_0265127
318 Ga0501043_0027286
319 Ga0501047_0593921
320 Ga0501035_0001005
321 Ga0501044_0548718
322 Ga0501044_0780201
323 nmdc:mga03n38_691699_c1
324 nmdc:mga0yw44_573538_c1
325 nmdc:mga0k408_232311_c1
326 nmdc:mga0k408_33408_c1
327 nmdc:mga07m45_2281_c1
328 nmdc:mga09592_169069_c1
329 Ga0500636_0111011
330 Ga0500552_047090
331 2990712661
332 2643993425
333 2842734979
334 2885192533
335 2894025939
336 2919707502

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01035

DNA_binding_1

6-O-methylguanine DNA methyltransferase, DNA binding domain

102

184

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4enn-assembly1.cif.gz_A crystal structure of s. pombe atl1 in complex with damaged dna containing o6-carboxymethylguanine 0.8996 99 182
4zye-assembly1.cif.gz_A crystal structure of sulfolobus solfataricus o6-methylguanine methyltransferase 0.8618 13 183
6ga0-assembly1.cif.gz_A crystal structure of a thermophilic o6-alkylguanine-dna alkyltransferase-derived self-labeling protein-tag in covalent complex with snap-vista green 0.859 13 182
8aes-assembly8.cif.gz_H crystal structure of a thermophilic o6-alkylguanine-dna alkyltransferase-derived self-labeling protein-tag 0.8534 13 183
3gx4-assembly1.cif.gz_X crystal structure analysis of s. pombe atl in complex with dna 0.8502 99 182
ID Description Score Start End Superfamily
af_P26188_97_181_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9459 98 180 1.10.10.10
af_Q5A0Y8_92_172_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9295 98 180 1.10.10.10
af_Q4DAC5_49_134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9246 98 182 1.10.10.10
4hduA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9006 97 182 1.10.10.10
af_Q5A0Y8_92_172_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.897 98 180 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1H7GM04-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase 0.975 12 190 GO:0003908
GO:0006281
GO:0032259
AF-A0A1H7GM04-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase 0.9697 12 190 GO:0003908
GO:0006281
GO:0032259
AF-A0A542XQN0-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9674 12 180 GO:0003908
GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032259
GO:0032993
GO:0043916
AF-A0A840AGY4-F1-model_v4 Methylated-DNA-[protein]-cysteine S-methyltransferase (EC 2.1.1.63) 0.9668 13 184 GO:0003908
GO:0006281
GO:0032259
AF-A0A1W9QDH7-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.959 12 180 GO:0003908
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032259
GO:0032993
GO:0043916

Map