F253680

General Info

Members Datasets Scaffolds Average Seq Length
168 135 336 276

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606372|2808903395
Length 308
Sequence DVRPTASPVPVPEPDPAPDAAIRRMPPAPPLRATRPGRSGRRLTIAVGAALAVGALITAFPFVWMLFSSVKPQSESIDYPPKLLPQEPTFEYYVRLFTELDFGRYLVNTLIVVAIGAVGLLFMAMAGFAFAKYDFRGKGGLFFLVIATMMIPVQVTMIPTYLILNGFKLTNTLVGIALPTLVSGFGIFLFRQFMVTIPTEMLEAARIDGAGEIRTFLTIALPMSKPILAVQAVLTFIAGWNSFLWPLIIASDQKLYTLSVGLALLNQQLAVNPSLQMAAASVMVVPILIVFIVFQRHVVQGFALSGLK

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
64 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
75 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
76 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
79 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
80 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
81 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
82 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
86 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
87 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
88 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
100 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
101 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
102 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
105 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
106 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
109 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
110 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
113 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
114 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 2808606372 Agromyces sp. 23-23 Isolate Unclassified
116 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
117 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
118 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
119 2643221607 Rhizobium sp. Root73 Isolate Unclassified
120 2643221618 Ensifer sp. Root231 Isolate Unclassified
121 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
122 2643221655 Ensifer sp. Root1252 Isolate Unclassified
123 2643221659 Ensifer sp. Root127 Isolate Unclassified
124 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
125 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
126 2643221698 Ensifer sp. Root142 Isolate Unclassified
127 2643221712 Ensifer sp. Root258 Isolate Unclassified
128 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
129 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
130 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
131 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
132 2928153084 Leifsonia sp. 563 Isolate Unclassified
133 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
134 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
135 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.31
Metatranscriptomes 1.19
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.67
Nodule 0
Rhizoplane 1.19
Rhizosphere 61.9
Stem 0
Stem Tuber 0
Unclassified 2.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10376639 3300003322 Unclassified 1393
2 rootH1_10022124 3300003323 Bacteria 2469
3 Ga0006562J51391_1074696 3300003578 Bacteria 7410
4 Ga0055539_1012708 3300003752 Bacteria 1034
5 Ga0070658_10407793 3300005327 Bacteria 1168
6 Ga0070666_10148128 3300005335 Bacteria 1637
7 Ga0070680_100035265 3300005336 Bacteria 4038
8 Ga0070660_100062611 3300005339 Bacteria 2891
9 Ga0070694_100210008 3300005444 Bacteria 1455
10 Ga0070708_100000001 3300005445 Bacteria 245117
11 Ga0070708_100004623 3300005445 Bacteria 10842
12 Ga0070663_100018893 3300005455 Bacteria 4530
13 Ga0068867_100191499 3300005459 Bacteria 1632
14 Ga0070706_100000004 3300005467 Bacteria 281790
15 Ga0070706_100000756 3300005467 Bacteria 36194
16 Ga0070707_100000002 3300005468 Bacteria 291540
17 Ga0070707_100004337 3300005468 Bacteria 13288
18 Ga0070707_100016581 3300005468 Bacteria 6915
19 Ga0070707_100024476 3300005468 Bacteria 5719
20 Ga0070707_100378366 3300005468 Bacteria 1375
21 Ga0070698_100005054 3300005471 Bacteria 14456
22 Ga0070698_100241789 3300005471 Bacteria 1738
23 Ga0070699_100000073 3300005518 Bacteria 95396
24 Ga0070699_100000448 3300005518 Bacteria 39507
25 Ga0070699_100014251 3300005518 Bacteria 6839
26 Ga0070679_100061758 3300005530 Bacteria 3735
27 Ga0070697_100052383 3300005536 Bacteria 3316
28 Ga0070665_100126384 3300005548 Bacteria 2559
29 Ga0070665_100134351 3300005548 Bacteria 2476
30 Ga0070704_100002876 3300005549 Bacteria 9760
31 Ga0068855_100036708 3300005563 Bacteria 5830
32 Ga0068855_100186319 3300005563 Bacteria 2344
33 Ga0068861_100025407 3300005719 Bacteria 4296
34 Ga0068861_100217941 3300005719 Bacteria 1611
35 Ga0068863_100018120 3300005841 Bacteria 6742
36 Ga0081455_10000157 3300005937 Bacteria 82320
37 Ga0081540_1011855 3300005983 Bacteria 5791
38 Ga0081539_10005471 3300005985 Bacteria 12938
39 Ga0070717_10182069 3300006028 Bacteria 1832
40 Ga0075365_10245096 3300006038 Bacteria 1259
41 Ga0075368_10029608 3300006042 Bacteria 2117
42 Ga0075363_100023256 3300006048 Bacteria 3139
43 Ga0075363_100030994 3300006048 Bacteria 2770
44 Ga0075364_10038352 3300006051 Bacteria 3104
45 Ga0075362_10005574 3300006177 Bacteria 4621
46 Ga0075367_10003256 3300006178 Bacteria 7687
47 Ga0075369_10017312 3300006186 Bacteria 2919
48 Ga0075369_10040633 3300006186 Bacteria 1989
49 Ga0075370_10096121 3300006353 Bacteria 1712
50 Ga0068871_100610198 3300006358 Unclassified 993
51 Ga0075428_100244013 3300006844 Bacteria 1938
52 Ga0075431_100020202 3300006847 Bacteria 6803
53 Ga0075436_100223107 3300006914 Bacteria 1338
54 Ga0105245_10270561 3300009098 Bacteria 1657
55 Ga0105243_10040596 3300009148 Bacteria 3635
56 Ga0105242_10138671 3300009176 Bacteria 2108
57 Ga0105248_10028464 3300009177 Bacteria 6225
58 Ga0105238_10452241 3300009551 Bacteria 1281
59 Ga0105249_10372531 3300009553 Bacteria 1452
60 Ga0105239_10117983 3300010375 Bacteria 2945
61 Ga0163163_10024763 3300014325 Bacteria 5714
62 Ga0209677_100879 3300025253 Bacteria 14745
63 Ga0207653_10013030 3300025885 Bacteria 2601
64 Ga0207680_10236165 3300025903 Bacteria 1258
65 Ga0207705_10330064 3300025909 Bacteria 1173
66 Ga0207684_10000003 3300025910 Bacteria 766933
67 Ga0207684_10000033 3300025910 Bacteria 291567
68 Ga0207684_10000436 3300025910 Bacteria 55372
69 Ga0207684_10063130 3300025910 Bacteria 3145
70 Ga0207660_10054547 3300025917 Bacteria 2853
71 Ga0207652_10012079 3300025921 Bacteria 6972
72 Ga0207646_10000007 3300025922 Bacteria 478285
73 Ga0207646_10000043 3300025922 Bacteria 184713
74 Ga0207646_10000608 3300025922 Bacteria 46550
75 Ga0207646_10013847 3300025922 Bacteria 7692
76 Ga0207646_10313560 3300025922 Bacteria 1417
77 Ga0207646_10358086 3300025922 Bacteria 1318
78 Ga0207667_10236911 3300025949 Bacteria 1868
79 Ga0207712_10418924 3300025961 Bacteria 1129
80 Ga0207658_10364389 3300025986 Bacteria 1262
81 Ga0207639_10105600 3300026041 Bacteria 2285
82 Ga0207641_10020468 3300026088 Bacteria 5433
83 Ga0207676_10440203 3300026095 Unclassified 1227
84 Ga0207675_100061774 3300026118 Bacteria 3497
85 Ga0209813_10061230 3300027866 Bacteria 1202
86 Ga0307517_10135974 3300028786 Bacteria 1748
87 Ga0307515_10000068 3300028794 Bacteria 242305
88 Ga0307515_10274603 3300028794 Bacteria 1401
89 Ga0307513_10002899 3300031456 Bacteria 23470
90 Ga0307513_10319932 3300031456 Bacteria 1310
91 Ga0307514_10002316 3300031649 Bacteria 20059
92 Ga0307514_10084864 3300031649 Bacteria 2330
93 Ga0307406_10000551 3300031901 Bacteria 21586
94 Ga0395899_0001898 3300037312 Bacteria 17259
95 Ga0395899_0018487 3300037312 Bacteria 5298
96 Ga0395900_0009425 3300037418 Bacteria 10007
97 Ga0395900_0031405 3300037418 Bacteria 5456
98 Ga0395898_0018679 3300037466 Bacteria 7067
99 Ga0395905_0010250 3300037471 Bacteria 9129
100 Ga0395901_0005316 3300038443 Bacteria 13011
101 Ga0466965_0000010 3300044683 Bacteria 112032
102 Ga0453684_0277661 3300044712 Unclassified 1912
103 Ga0495590_0000076 3300046457 Bacteria 68651
104 Ga0495650_0001393 3300046471 Bacteria 23768
105 Ga0495672_0007930 3300047320 Bacteria 7917
106 Ga0495686_0084521 3300047472 Bacteria 1934
107 Ga0496104_0085520 3300048907 Bacteria 3010
108 Ga0496116_0060105 3300048919 Bacteria 2467
109 Ga0496117_0025045 3300048920 Bacteria 4700
110 Ga0496119_0016537 3300048922 Bacteria 5608
111 Ga0496120_0055511 3300048923 Bacteria 2239
112 Ga0496122_0001773 3300048925 Bacteria 33062
113 Ga0496123_0003752 3300048926 Bacteria 16659
114 Ga0496126_0010953 3300048929 Bacteria 9445
115 Ga0501031_0098837 3300049568 Bacteria 1904
116 Ga0501032_0099833 3300049569 Bacteria 1923
117 Ga0501034_0043948 3300049571 Bacteria 4519
118 Ga0501034_0066471 3300049571 Bacteria 3618
119 Ga0501034_0137878 3300049571 Bacteria 2420
120 Ga0501034_0156836 3300049571 Bacteria 2249
121 Ga0501036_0100472 3300049572 Bacteria 2447
122 Ga0501038_0024455 3300049574 Bacteria 5389
123 Ga0501038_0192002 3300049574 Bacteria 1643
124 Ga0501043_0050366 3300049579 Bacteria 3273
125 Ga0501043_0352305 3300049579 Bacteria 1118
126 Ga0501070_0049103 3300049586 Bacteria 3504
127 Ga0501035_0117751 3300049822 Bacteria 2324
128 Ga0501044_0221792 3300049823 Bacteria 1841
129 Ga0501044_0376752 3300049823 Bacteria 1335
130 nmdc:mga03683_2188_c1 3300050489 Bacteria 6036
131 nmdc:mga03n38_36223_c1 3300050490 Bacteria 2120
132 nmdc:mga00v17_201272_c1 3300050491 Bacteria 1287
133 nmdc:mga0yw44_12818_c1 3300050492 Bacteria 4386
134 nmdc:mga06z11_5413_c1 3300050494 Bacteria 5118
135 nmdc:mga04h51_17059_c1 3300050495 Bacteria 2117
136 nmdc:mga06r32_19804_c1 3300050510 Bacteria 6184
137 nmdc:mga08x19_249772_c1 3300050514 Bacteria 1224
138 nmdc:mga0sz30_15530_c1 3300050516 Bacteria 3010
139 Ga0500651_0000211 3300053093 Bacteria 36797
140 Ga0500556_0000145 3300053104 Bacteria 59342
141 Ga0500562_002665 3300053108 Bacteria 4440
142 Ga0500593_003959 3300053117 Bacteria 5681
143 Ga0500568_0001795 3300053139 Bacteria 13209
144 Ga0500616_0076499 3300053153 Bacteria 1692
145 Ga0500620_000678 3300053155 Bacteria 5827
146 Ga0500638_052837 3300053162 Bacteria 1962
147 Ga0587109_033646 3300059624 Unclassified 986
148 2808903395 2808606372 Bacteria 4649509
149 2600197923 2599185352 Bacteria 7228948
150 2643777988 2643221551 Bacteria 3750538
151 2643796436 2643221555 Bacteria 3749717
152 2644048618 2643221607 Bacteria 6314006
153 2644109762 2643221618 Bacteria 7717186
154 2644202121 2643221636 Bacteria 6583769
155 2644312640 2643221655 Bacteria 7722067
156 2644336808 2643221659 Bacteria 7890716
157 2644481420 2643221686 Bacteria 6310811
158 2644526385 2643221694 Bacteria 4392972
159 2644540955 2643221698 Bacteria 7756764
160 2644618371 2643221712 Bacteria 7729434
161 2644671060 2643221722 Bacteria 4247614
162 2774398111 2773857763 Bacteria 4180068
163 2808884160 2808606368 Bacteria 3174172
164 2857736725 2857733635 Bacteria 3532004
165 2928155578 2928153084 Bacteria 4020257
166 2939659313 2939657138 Bacteria 3740283
167 2939663258 2939660829 Bacteria 3784848
168 2964328036 2964326757 Bacteria 3290868
169 rootL2_10376639
170 rootH1_10022124
171 Ga0006562J51391_1074696
172 Ga0055539_1012708
173 Ga0070658_10407793
174 Ga0070666_10148128
175 Ga0070680_100035265
176 Ga0070660_100062611
177 Ga0070694_100210008
178 Ga0070708_100000001
179 Ga0070708_100004623
180 Ga0070663_100018893
181 Ga0068867_100191499
182 Ga0070706_100000004
183 Ga0070706_100000756
184 Ga0070707_100000002
185 Ga0070707_100004337
186 Ga0070707_100016581
187 Ga0070707_100024476
188 Ga0070707_100378366
189 Ga0070698_100005054
190 Ga0070698_100241789
191 Ga0070699_100000073
192 Ga0070699_100000448
193 Ga0070699_100014251
194 Ga0070679_100061758
195 Ga0070697_100052383
196 Ga0070665_100126384
197 Ga0070665_100134351
198 Ga0070704_100002876
199 Ga0068855_100036708
200 Ga0068855_100186319
201 Ga0068861_100025407
202 Ga0068861_100217941
203 Ga0068863_100018120
204 Ga0081455_10000157
205 Ga0081540_1011855
206 Ga0081539_10005471
207 Ga0070717_10182069
208 Ga0075365_10245096
209 Ga0075368_10029608
210 Ga0075363_100023256
211 Ga0075363_100030994
212 Ga0075364_10038352
213 Ga0075362_10005574
214 Ga0075367_10003256
215 Ga0075369_10017312
216 Ga0075369_10040633
217 Ga0075370_10096121
218 Ga0068871_100610198
219 Ga0075428_100244013
220 Ga0075431_100020202
221 Ga0075436_100223107
222 Ga0105245_10270561
223 Ga0105243_10040596
224 Ga0105242_10138671
225 Ga0105248_10028464
226 Ga0105238_10452241
227 Ga0105249_10372531
228 Ga0105239_10117983
229 Ga0163163_10024763
230 Ga0209677_100879
231 Ga0207653_10013030
232 Ga0207680_10236165
233 Ga0207705_10330064
234 Ga0207684_10000003
235 Ga0207684_10000033
236 Ga0207684_10000436
237 Ga0207684_10063130
238 Ga0207660_10054547
239 Ga0207652_10012079
240 Ga0207646_10000007
241 Ga0207646_10000043
242 Ga0207646_10000608
243 Ga0207646_10013847
244 Ga0207646_10313560
245 Ga0207646_10358086
246 Ga0207667_10236911
247 Ga0207712_10418924
248 Ga0207658_10364389
249 Ga0207639_10105600
250 Ga0207641_10020468
251 Ga0207676_10440203
252 Ga0207675_100061774
253 Ga0209813_10061230
254 Ga0307517_10135974
255 Ga0307515_10000068
256 Ga0307515_10274603
257 Ga0307513_10002899
258 Ga0307513_10319932
259 Ga0307514_10002316
260 Ga0307514_10084864
261 Ga0307406_10000551
262 Ga0395899_0001898
263 Ga0395899_0018487
264 Ga0395900_0009425
265 Ga0395900_0031405
266 Ga0395898_0018679
267 Ga0395905_0010250
268 Ga0395901_0005316
269 Ga0466965_0000010
270 Ga0453684_0277661
271 Ga0495590_0000076
272 Ga0495650_0001393
273 Ga0495672_0007930
274 Ga0495686_0084521
275 Ga0496104_0085520
276 Ga0496116_0060105
277 Ga0496117_0025045
278 Ga0496119_0016537
279 Ga0496120_0055511
280 Ga0496122_0001773
281 Ga0496123_0003752
282 Ga0496126_0010953
283 Ga0501031_0098837
284 Ga0501032_0099833
285 Ga0501034_0043948
286 Ga0501034_0066471
287 Ga0501034_0137878
288 Ga0501034_0156836
289 Ga0501036_0100472
290 Ga0501038_0024455
291 Ga0501038_0192002
292 Ga0501043_0050366
293 Ga0501043_0352305
294 Ga0501070_0049103
295 Ga0501035_0117751
296 Ga0501044_0221792
297 Ga0501044_0376752
298 nmdc:mga03683_2188_c1
299 nmdc:mga03n38_36223_c1
300 nmdc:mga00v17_201272_c1
301 nmdc:mga0yw44_12818_c1
302 nmdc:mga06z11_5413_c1
303 nmdc:mga04h51_17059_c1
304 nmdc:mga06r32_19804_c1
305 nmdc:mga08x19_249772_c1
306 nmdc:mga0sz30_15530_c1
307 Ga0500651_0000211
308 Ga0500556_0000145
309 Ga0500562_002665
310 Ga0500593_003959
311 Ga0500568_0001795
312 Ga0500616_0076499
313 Ga0500620_000678
314 Ga0500638_052837
315 Ga0587109_033646
316 2808903395
317 2600197923
318 2643777988
319 2643796436
320 2644048618
321 2644109762
322 2644202121
323 2644312640
324 2644336808
325 2644481420
326 2644526385
327 2644540955
328 2644618371
329 2644671060
330 2774398111
331 2808884160
332 2857736725
333 2928155578
334 2939659313
335 2939663258
336 2964328036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

303

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8388 1 272
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.8095 12 268
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8049 8 274
8ja7-assembly1.cif.gz_B cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.7994 12 277
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.798 12 283
ID Description Score Start End Superfamily
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8963 6 269 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8957 8 273 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8879 8 273 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8872 1 273 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8838 6 269 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0S4PLR2-F1-model_v4 deleted 0.9442 8 283
AF-A0A2N2BJW0-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.943 6 283 GO:0005886
GO:0055085
AF-A0A0S8CE79-F1-model_v4 Glycerol-3-phosphate ABC transporter permease 0.9429 17 283 GO:0005886
GO:0055085
AF-A0A3D5IGC2-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9405 9 283 GO:0005524
GO:0005886
GO:0055085
AF-A0A2N2BJW0-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9397 6 283 GO:0005886
GO:0055085

Map