F253606

General Info

Members Datasets Scaffolds Average Seq Length
168 117 336 281

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0001210|Ga0500616_0001210_7702_8565
Length 273
Sequence MTDTSYEAEVTAKAAESGGNATKEFLERQAAARAAQGVDHARVSRLAGRAIQALNDVITEEKLTYGEYNALKAWLIKVGEDGEWPLFLDVWLEHSVEEVANAHRKGSKGTIEGPYYVRDNEPGTPLVFKGQVRAVDGTPLPAAKVELWHADDLGFYSQFAPGLPEWNLRSTFIANERGEFEIHTMRPAPYQIPTEGACGVLIEAAGWHAWRPAHLHLKVSAPGYELITTQLYFPGDPHNEDDIASAVKPELLLDPHEVDGGEETVYDFILDPE

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
5 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
6 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
7 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
8 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
9 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
10 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
11 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
12 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
13 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
14 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
15 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
16 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
17 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
18 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
19 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
20 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
21 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
22 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
23 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
24 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
25 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
26 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
27 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
28 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
29 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
32 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
33 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
34 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
35 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
36 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
37 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
38 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
39 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
40 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
41 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
42 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
43 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
44 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
54 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
55 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
60 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
61 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
62 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
63 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
64 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
65 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
66 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
67 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
68 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
69 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
70 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
77 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
79 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
80 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
81 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
82 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
83 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
84 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
85 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
86 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
87 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
88 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
89 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
90 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
91 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
92 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
93 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
94 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
98 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
99 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
100 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
101 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
102 2643221604 Nocardioides sp. Root190 Isolate Unclassified
103 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
104 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
105 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
106 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
107 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
108 2862574272 Streptomyces sp. AcE210 Isolate Nodule
109 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
110 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
111 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
112 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
113 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
114 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
115 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
116 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
117 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.5
Metatranscriptomes 0
Isolates 12.5

Biome Distribution

Category Percentage (%)
Aerial Root 1.19
Bulb 0
Endosphere 4.76
Nodule 0.6
Rhizoplane 3.57
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0001210 3300053153 Bacteria 26060
2 LJQas_1000336 3300000549 Bacteria 8139
3 Ga0070709_10157893 3300005434 Bacteria 1574
4 Ga0070663_100001282 3300005455 Bacteria 13765
5 Ga0075432_10032518 3300006058 Bacteria 1807
6 Ga0070712_100201140 3300006175 Bacteria 1565
7 Ga0157369_10448141 3300013105 Bacteria 1337
8 Ga0207426_1021749 3300025302 Bacteria 2212
9 Ga0207678_10000313 3300026067 Bacteria 43785
10 Ga0207428_10006323 3300027907 Bacteria 10951
11 Ga0307515_10041247 3300028794 Bacteria 7263
12 Ga0307511_10001365 3300030521 Bacteria 25829
13 Ga0307513_10009885 3300031456 Bacteria 12037
14 Ga0307513_10116316 3300031456 Bacteria 2654
15 Ga0307509_10005713 3300031507 Bacteria 17145
16 Ga0307509_10344225 3300031507 Bacteria 1217
17 Ga0307408_100004581 3300031548 Bacteria 9363
18 Ga0307408_100039172 3300031548 Bacteria 3348
19 Ga0307408_100076626 3300031548 Bacteria 2488
20 Ga0307408_100287926 3300031548 Bacteria 1371
21 Ga0307516_10302185 3300031730 Bacteria 1276
22 Ga0307405_10073164 3300031731 Bacteria 2211
23 Ga0307405_10203916 3300031731 Bacteria 1438
24 Ga0307405_10315208 3300031731 Bacteria 1192
25 Ga0307405_10349702 3300031731 Bacteria 1140
26 Ga0307413_10012735 3300031824 Bacteria 4196
27 Ga0307413_10015139 3300031824 Bacteria 3944
28 Ga0307413_10461026 3300031824 Bacteria 1011
29 Ga0307518_10000028 3300031838 Bacteria 98010
30 Ga0307410_10004886 3300031852 Bacteria 7016
31 Ga0307410_10034478 3300031852 Bacteria 3278
32 Ga0307410_10135585 3300031852 Bacteria 1814
33 Ga0307406_10032381 3300031901 Bacteria 3191
34 Ga0307406_10092485 3300031901 Bacteria 2040
35 Ga0307406_10193184 3300031901 Bacteria 1492
36 Ga0307406_10383324 3300031901 Bacteria 1109
37 Ga0307407_10000556 3300031903 Bacteria 11697
38 Ga0307407_10011908 3300031903 Bacteria 4161
39 Ga0307407_10125368 3300031903 Bacteria 1635
40 Ga0307407_10317300 3300031903 Bacteria 1092
41 Ga0307412_10010413 3300031911 Bacteria 5355
42 Ga0307412_10010423 3300031911 Bacteria 5353
43 Ga0307412_10048038 3300031911 Bacteria 2805
44 Ga0307412_10051158 3300031911 Bacteria 2729
45 Ga0307409_100014356 3300031995 Bacteria 5148
46 Ga0307409_100104878 3300031995 Bacteria 2355
47 Ga0307409_100129668 3300031995 Bacteria 2152
48 Ga0307409_100779565 3300031995 Bacteria 962
49 Ga0307416_100005982 3300032002 Bacteria 7562
50 Ga0307416_100019148 3300032002 Bacteria 4846
51 Ga0307416_100033099 3300032002 Bacteria 3914
52 Ga0307416_100078972 3300032002 Bacteria 2772
53 Ga0307416_100146828 3300032002 Bacteria 2155
54 Ga0307414_10014417 3300032004 Bacteria 4738
55 Ga0307414_10212354 3300032004 Bacteria 1583
56 Ga0307411_10002427 3300032005 Bacteria 8238
57 Ga0307415_100013728 3300032126 Bacteria 4737
58 Ga0307415_100336684 3300032126 Bacteria 1265
59 Ga0307507_10100372 3300033179 Bacteria 2425
60 Ga0395900_0240249 3300037418 Bacteria 1818
61 Ga0395900_0390382 3300037418 Bacteria 1358
62 Ga0395898_0001893 3300037466 Bacteria 26701
63 Ga0395898_0014638 3300037466 Bacteria 8056
64 Ga0436364_0139643 3300037853 Bacteria 10617
65 Ga0439436_0006290 3300041404 Bacteria 3647
66 Ga0439438_021708 3300041405 Bacteria 1788
67 Ga0451791_1136176 3300041451 Bacteria 2375
68 Ga0451841_0603256 3300041498 Bacteria 1111
69 Ga0451853_3010694 3300041512 Bacteria 2874
70 Ga0439433_0005344 3300041999 Bacteria 2757
71 Ga0439442_000108 3300042002 Bacteria 20393
72 Ga0439449_0012077 3300042007 Bacteria 3246
73 Ga0439457_027182 3300042014 Bacteria 1266
74 Ga0439462_0011254 3300042015 Bacteria 2276
75 Ga0450920_000003 3300042122 Bacteria 43364
76 Ga0450907_001412 3300042146 Bacteria 5233
77 Ga0466972_0010037 3300044658 Bacteria 4755
78 Ga0466965_0007011 3300044683 Bacteria 5158
79 Ga0466966_0007394 3300044684 Bacteria 7287
80 Ga0466966_0039996 3300044684 Bacteria 3018
81 Ga0466961_0243564 3300044693 Bacteria 1105
82 Ga0466963_0017388 3300044694 Bacteria 4483
83 Ga0466963_0056854 3300044694 Bacteria 2604
84 Ga0466971_0015882 3300044719 Bacteria 3317
85 Ga0466970_0007415 3300044765 Bacteria 5495
86 Ga0466957_0028236 3300044842 Bacteria 3340
87 Ga0466957_0328479 3300044842 Bacteria 1033
88 Ga0466957_0409559 3300044842 Bacteria 929
89 Ga0466960_0002258 3300044901 Bacteria 7201
90 Ga0466960_0008746 3300044901 Bacteria 4155
91 Ga0466960_0044935 3300044901 Bacteria 2108
92 Ga0466960_0152355 3300044901 Bacteria 1236
93 Ga0466959_0009039 3300045049 Bacteria 7069
94 Ga0466959_0074735 3300045049 Bacteria 2450
95 Ga0466959_0243915 3300045049 Bacteria 1240
96 Ga0466958_0049834 3300045836 Bacteria 2535
97 Ga0466967_0279069 3300045976 Bacteria 1603
98 Ga0495603_0001683 3300046455 Bacteria 12993
99 Ga0495629_0007004 3300046459 Bacteria 8306
100 Ga0495611_0010129 3300046648 Bacteria 3989
101 Ga0495611_0042043 3300046648 Bacteria 2040
102 Ga0495625_0173924 3300046660 Bacteria 1436
103 Ga0495600_0063574 3300046809 Bacteria 2412
104 Ga0495581_0139409 3300047315 Bacteria 1414
105 Ga0495636_0001755 3300047318 Bacteria 8263
106 Ga0495687_003383 3300047443 Bacteria 11627
107 Ga0495687_018842 3300047443 Bacteria 3400
108 Ga0495685_001492 3300047447 Bacteria 7162
109 Ga0496102_0025459 3300048905 Bacteria 5267
110 Ga0496102_0224337 3300048905 Bacteria 1772
111 Ga0496103_0012573 3300048906 Bacteria 5019
112 Ga0496106_0097270 3300048909 Bacteria 2279
113 Ga0496111_0032241 3300048914 Bacteria 3735
114 Ga0501031_0056208 3300049568 Bacteria 2564
115 Ga0501033_0168445 3300049570 Bacteria 1574
116 Ga0501038_0103779 3300049574 Bacteria 2364
117 Ga0501039_0032800 3300049575 Bacteria 4005
118 Ga0501040_0078558 3300049576 Bacteria 2283
119 Ga0501040_0239666 3300049576 Bacteria 1293
120 Ga0501043_0149467 3300049579 Bacteria 1828
121 Ga0501046_0103115 3300049580 Bacteria 2187
122 Ga0501046_0178047 3300049580 Bacteria 1592
123 Ga0501048_0071884 3300049582 Bacteria 2442
124 Ga0501048_0252466 3300049582 Bacteria 1252
125 Ga0501067_0053828 3300049583 Bacteria 2230
126 Ga0501068_0048178 3300049584 Bacteria 2572
127 Ga0501069_0020880 3300049585 Bacteria 3551
128 Ga0501072_0055225 3300049588 Bacteria 3130
129 Ga0501072_0299756 3300049588 Bacteria 1278
130 Ga0501074_0111701 3300049590 Bacteria 1955
131 Ga0501075_0076504 3300049591 Bacteria 2532
132 Ga0501075_0242933 3300049591 Bacteria 1373
133 Ga0501076_0278616 3300049592 Bacteria 1370
134 Ga0501077_0157325 3300049593 Bacteria 1442
135 Ga0501077_0333874 3300049593 Bacteria 967
136 Ga0501079_0147864 3300049741 Bacteria 1831
137 Ga0501080_0299632 3300049742 Bacteria 1458
138 Ga0501045_0087534 3300049824 Bacteria 2300
139 nmdc:mga00v17_56817_c1 3300050491 Bacteria 2393
140 nmdc:mga0yw44_32370_c1 3300050492 Bacteria 3047
141 Ga0500566_0034738 3300053094 Bacteria 2932
142 Ga0500660_007191 3300053100 Bacteria 5920
143 Ga0500560_000103 3300053107 Bacteria 8711
144 Ga0500568_0000095 3300053139 Bacteria 82601
145 Ga0501084_0132387 3300054114 Bacteria 2099
146 Ga0466962_0013031 3300061719 Bacteria 3999
147 Ga0530510_0034302 3300061734 Bacteria 3654
148 2523386396 2523231044 Bacteria 6434991
149 2537897955 2537561592 Bacteria 4348607
150 2585309813 2582581313 Bacteria 10042643
151 2586061174 2585427649 Bacteria 9053857
152 2644035392 2643221604 Bacteria 5014917
153 2809198359 2808606439 Bacteria 5952208
154 2812349553 2811994878 Bacteria 5992952
155 2812374501 2811994882 Bacteria 4688362
156 2819728537 2818991469 Bacteria 4644110
157 2862508357 2862507626 Bacteria 9425308
158 2862581642 2862574272 Bacteria 10567477
159 2863075425 2863067949 Bacteria 8541735
160 2866554330 2866552031 Bacteria 5824618
161 2870803486 2870801768 Bacteria 2710986
162 2891969403 2891968417 Bacteria 5821697
163 2917744633 2917736166 Bacteria 9690793
164 2984578571 2984576629 Bacteria 4248407
165 2990259377 2990256926 Bacteria 4252839
166 8003317202 8003314358 Bacteria 10575343
167 8003319262 8003314358 Bacteria 10575343
168 8004022598 8004021418 Bacteria 4313954
169 Ga0500616_0001210
170 LJQas_1000336
171 Ga0070709_10157893
172 Ga0070663_100001282
173 Ga0075432_10032518
174 Ga0070712_100201140
175 Ga0157369_10448141
176 Ga0207426_1021749
177 Ga0207678_10000313
178 Ga0207428_10006323
179 Ga0307515_10041247
180 Ga0307511_10001365
181 Ga0307513_10009885
182 Ga0307513_10116316
183 Ga0307509_10005713
184 Ga0307509_10344225
185 Ga0307408_100004581
186 Ga0307408_100039172
187 Ga0307408_100076626
188 Ga0307408_100287926
189 Ga0307516_10302185
190 Ga0307405_10073164
191 Ga0307405_10203916
192 Ga0307405_10315208
193 Ga0307405_10349702
194 Ga0307413_10012735
195 Ga0307413_10015139
196 Ga0307413_10461026
197 Ga0307518_10000028
198 Ga0307410_10004886
199 Ga0307410_10034478
200 Ga0307410_10135585
201 Ga0307406_10032381
202 Ga0307406_10092485
203 Ga0307406_10193184
204 Ga0307406_10383324
205 Ga0307407_10000556
206 Ga0307407_10011908
207 Ga0307407_10125368
208 Ga0307407_10317300
209 Ga0307412_10010413
210 Ga0307412_10010423
211 Ga0307412_10048038
212 Ga0307412_10051158
213 Ga0307409_100014356
214 Ga0307409_100104878
215 Ga0307409_100129668
216 Ga0307409_100779565
217 Ga0307416_100005982
218 Ga0307416_100019148
219 Ga0307416_100033099
220 Ga0307416_100078972
221 Ga0307416_100146828
222 Ga0307414_10014417
223 Ga0307414_10212354
224 Ga0307411_10002427
225 Ga0307415_100013728
226 Ga0307415_100336684
227 Ga0307507_10100372
228 Ga0395900_0240249
229 Ga0395900_0390382
230 Ga0395898_0001893
231 Ga0395898_0014638
232 Ga0436364_0139643
233 Ga0439436_0006290
234 Ga0439438_021708
235 Ga0451791_1136176
236 Ga0451841_0603256
237 Ga0451853_3010694
238 Ga0439433_0005344
239 Ga0439442_000108
240 Ga0439449_0012077
241 Ga0439457_027182
242 Ga0439462_0011254
243 Ga0450920_000003
244 Ga0450907_001412
245 Ga0466972_0010037
246 Ga0466965_0007011
247 Ga0466966_0007394
248 Ga0466966_0039996
249 Ga0466961_0243564
250 Ga0466963_0017388
251 Ga0466963_0056854
252 Ga0466971_0015882
253 Ga0466970_0007415
254 Ga0466957_0028236
255 Ga0466957_0328479
256 Ga0466957_0409559
257 Ga0466960_0002258
258 Ga0466960_0008746
259 Ga0466960_0044935
260 Ga0466960_0152355
261 Ga0466959_0009039
262 Ga0466959_0074735
263 Ga0466959_0243915
264 Ga0466958_0049834
265 Ga0466967_0279069
266 Ga0495603_0001683
267 Ga0495629_0007004
268 Ga0495611_0010129
269 Ga0495611_0042043
270 Ga0495625_0173924
271 Ga0495600_0063574
272 Ga0495581_0139409
273 Ga0495636_0001755
274 Ga0495687_003383
275 Ga0495687_018842
276 Ga0495685_001492
277 Ga0496102_0025459
278 Ga0496102_0224337
279 Ga0496103_0012573
280 Ga0496106_0097270
281 Ga0496111_0032241
282 Ga0501031_0056208
283 Ga0501033_0168445
284 Ga0501038_0103779
285 Ga0501039_0032800
286 Ga0501040_0078558
287 Ga0501040_0239666
288 Ga0501043_0149467
289 Ga0501046_0103115
290 Ga0501046_0178047
291 Ga0501048_0071884
292 Ga0501048_0252466
293 Ga0501067_0053828
294 Ga0501068_0048178
295 Ga0501069_0020880
296 Ga0501072_0055225
297 Ga0501072_0299756
298 Ga0501074_0111701
299 Ga0501075_0076504
300 Ga0501075_0242933
301 Ga0501076_0278616
302 Ga0501077_0157325
303 Ga0501077_0333874
304 Ga0501079_0147864
305 Ga0501080_0299632
306 Ga0501045_0087534
307 nmdc:mga00v17_56817_c1
308 nmdc:mga0yw44_32370_c1
309 Ga0500566_0034738
310 Ga0500660_007191
311 Ga0500560_000103
312 Ga0500568_0000095
313 Ga0501084_0132387
314 Ga0466962_0013031
315 Ga0530510_0034302
316 2523386396
317 2537897955
318 2585309813
319 2586061174
320 2644035392
321 2809198359
322 2812349553
323 2812374501
324 2819728537
325 2862508357
326 2862581642
327 2863075425
328 2866554330
329 2870803486
330 2891969403
331 2917744633
332 2984578571
333 2990259377
334 8003317202
335 8003319262
336 8004022598

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04444

Dioxygenase_N

Catechol dioxygenase N terminus

40

108

0.97

PF00775

Dioxygenase_C

Dioxygenase

105

272

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hkp-assembly1.cif.gz_A-2 crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with protocatechuate 0.9425 12 265
3hgi-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp 0.9378 14 265
2boy-assembly2.cif.gz_B-3 crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp 0.9333 15 265
3hkp-assembly1.cif.gz_A-2 crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with protocatechuate 0.9319 12 265
2boy-assembly3.cif.gz_G crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp 0.9296 15 265
ID Description Score Start End Superfamily
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.969 82 265 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9588 82 265 2.60.130.10
2boyB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9333 15 265 2.60.130.10
2boyB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9263 15 265 2.60.130.10
1s9aB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9115 15 265 2.60.130.10
ID Description Score Start End GO Terms
AF-Q0QZV5-F1-model_v4 Chlorocatechol 1,2-dioxygenase 0.9858 112 215 GO:0008199
GO:0016702
AF-A0A4Y3VZ39-F1-model_v4 deleted 0.9831 175 266
AF-A0A3D3H6S8-F1-model_v4 Catechol 1,2-dioxygenase 0.9831 185 265 GO:0008199
GO:0016702
AF-Q0QZV6-F1-model_v4 Chlorocatechol 1,2-dioxygenase 0.9818 112 215 GO:0008199
GO:0016702
AF-H5U7C9-F1-model_v4 Putative dioxygenase 0.9802 149 266 GO:0008199
GO:0016702

Map