F253344

General Info

Members Datasets Scaffolds Average Seq Length
168 131 164 217

Family's Representative Sequence

Representative Sequence 3300046679|Ga0495623_0272118|Ga0495623_0272118_40_747
Length 235
Sequence VFGLSSKKTLPTPDDALTGRPEPLPGIPTTHEVLGTPLHGPWPEGTRVLYVAMGCFWGAERIFWKLPGVVTTAAGYMGGLTPNATYEEVCSGRTGHTEAVLVAYDPAVTSAETLLAAFWENHDPTQGFRQGNDVGSQYRSAIYWTTPEQEQAARATRAAFQDVLHAHGFGEITTELRPAQEAGEFYYAEDYHQQYLHKNPGGYCNHGPNGMTCPVGLVPQNELPSQTSVLPPTAG

Samples

Sample ID Description Type Environment
1 2643221580 Devosia sp. Root635 Isolate Unclassified
2 2643221674 Devosia sp. Root436 Isolate Unclassified
3 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
4 2932401849 Devosia sp. 2618 Isolate Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
51 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
52 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
85 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
94 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
95 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
96 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
127 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
130 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
131 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 1.79
Isolates 2.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.98
Nodule 0
Rhizoplane 2.38
Rhizosphere 90.48
Stem 0
Stem Tuber 0
Unclassified 4.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10051963 3300005327 Bacteria 3322
2 Ga0070683_100274267 3300005329 Bacteria 1604
3 Ga0070670_100109358 3300005331 Bacteria 2382
4 Ga0070670_100617590 3300005331 Bacteria 971
5 Ga0068869_100643282 3300005334 Bacteria 899
6 Ga0070682_100470983 3300005337 Bacteria 967
7 Ga0068868_100001291 3300005338 Bacteria 17250
8 Ga0070660_100616387 3300005339 Bacteria 908
9 Ga0070661_100015942 3300005344 Bacteria 5304
10 Ga0070661_100080197 3300005344 Bacteria 2409
11 Ga0070692_10068849 3300005345 Bacteria 1881
12 Ga0070692_10216726 3300005345 Bacteria 1129
13 Ga0070675_100039863 3300005354 Bacteria 3834
14 Ga0070659_100009753 3300005366 Bacteria 7057
15 Ga0070700_100007407 3300005441 Bacteria 5924
16 Ga0070694_100764565 3300005444 Bacteria 790
17 Ga0070663_100011906 3300005455 Bacteria 5485
18 Ga0070663_100186811 3300005455 Bacteria 1611
19 Ga0070662_100082846 3300005457 Bacteria 2393
20 Ga0070662_100879940 3300005457 Bacteria 764
21 Ga0070679_100028162 3300005530 Bacteria 5537
22 Ga0070684_100038238 3300005535 Bacteria 4121
23 Ga0070665_100182695 3300005548 Bacteria 2098
24 Ga0068855_100014993 3300005563 Bacteria 9334
25 Ga0070664_100018458 3300005564 Bacteria 5731
26 Ga0070664_100242063 3300005564 Bacteria 1620
27 Ga0068857_100080430 3300005577 Bacteria 2910
28 Ga0068857_100178610 3300005577 Bacteria 1931
29 Ga0068854_100000327 3300005578 Bacteria 31304
30 Ga0068854_100474730 3300005578 Bacteria 1049
31 Ga0070702_100078260 3300005615 Bacteria 1973
32 Ga0068852_100293917 3300005616 Bacteria 1570
33 Ga0068861_100039166 3300005719 Bacteria 3536
34 Ga0068863_101230857 3300005841 Bacteria 755
35 Ga0068860_100098703 3300005843 Bacteria 2785
36 Ga0068862_100117548 3300005844 Bacteria 2340
37 Ga0097621_100042211 3300006237 Bacteria 3673
38 Ga0097621_100314904 3300006237 Bacteria 1385
39 Ga0068871_100018440 3300006358 Bacteria 5304
40 Ga0075428_100023876 3300006844 Bacteria 6767
41 Ga0075430_100009492 3300006846 Bacteria 8223
42 Ga0075430_100021851 3300006846 Bacteria 5437
43 Ga0075433_10268637 3300006852 Bacteria 1512
44 Ga0075429_100125093 3300006880 Bacteria 2248
45 Ga0105240_10044695 3300009093 Bacteria 5625
46 Ga0111539_10022434 3300009094 Bacteria 7757
47 Ga0111539_10340465 3300009094 Bacteria 1746
48 Ga0111539_10878018 3300009094 Bacteria 1043
49 Ga0114129_10000085 3300009147 Bacteria 86976
50 Ga0105249_11080330 3300009553 Bacteria 872
51 Ga0105239_10354866 3300010375 Bacteria 1656
52 Ga0157370_10177831 3300013104 Bacteria 1978
53 Ga0157374_10006115 3300013296 Bacteria 10193
54 Ga0157372_10773357 3300013307 Bacteria 1116
55 Ga0206356_10992787 3300020070 Bacteria 1111
56 Ga0206351_10472023 3300020077 Bacteria 710
57 Ga0206353_10266825 3300020082 Bacteria 1134
58 Ga0213872_10000806 3300021361 Bacteria 22739
59 Ga0213872_10061080 3300021361 Bacteria 1704
60 Ga0207427_101083 3300025231 Bacteria 11132
61 Ga0209233_1000176 3300025261 Bacteria 142863
62 Ga0207643_10559647 3300025908 Bacteria 734
63 Ga0207705_10134891 3300025909 Bacteria 1839
64 Ga0207695_10025083 3300025913 Bacteria 6687
65 Ga0207662_10675464 3300025918 Bacteria 723
66 Ga0207652_10027419 3300025921 Bacteria 4747
67 Ga0207694_10587660 3300025924 Bacteria 936
68 Ga0207659_10010085 3300025926 Bacteria 5920
69 Ga0207690_10183900 3300025932 Bacteria 1576
70 Ga0207690_10619403 3300025932 Bacteria 885
71 Ga0207706_10148830 3300025933 Bacteria 2060
72 Ga0207689_10019011 3300025942 Bacteria 5795
73 Ga0207689_10395613 3300025942 Bacteria 1152
74 Ga0207661_10001872 3300025944 Bacteria 14421
75 Ga0207661_10195348 3300025944 Bacteria 1776
76 Ga0207679_10216392 3300025945 Bacteria 1610
77 Ga0207679_10235879 3300025945 Bacteria 1547
78 Ga0207667_10001299 3300025949 Bacteria 31318
79 Ga0207712_10174512 3300025961 Bacteria 1683
80 Ga0207640_10000313 3300025981 Bacteria 32457
81 Ga0207677_10055292 3300026023 Bacteria 2713
82 Ga0207678_10011611 3300026067 Bacteria 7738
83 Ga0207678_10207826 3300026067 Bacteria 1674
84 Ga0207708_10000673 3300026075 Bacteria 26177
85 Ga0207674_10006524 3300026116 Bacteria 13715
86 Ga0207674_10040434 3300026116 Bacteria 4829
87 Ga0207675_100052613 3300026118 Bacteria 3800
88 Ga0207698_10491563 3300026142 Bacteria 1192
89 Ga0209974_10084100 3300027876 Bacteria 1098
90 Ga0207428_10048815 3300027907 Bacteria 3394
91 Ga0268265_10171168 3300028380 Bacteria 1856
92 Ga0268264_10477644 3300028381 Bacteria 1212
93 Ga0265318_10054918 3300028577 Bacteria 1492
94 Ga0265338_10351679 3300028800 Bacteria 1059
95 Ga0265327_10020118 3300031251 Bacteria 4079
96 Ga0307408_100222207 3300031548 Bacteria 1542
97 Ga0307413_10102023 3300031824 Bacteria 1898
98 Ga0307410_10048798 3300031852 Bacteria 2838
99 Ga0307407_10035665 3300031903 Bacteria 2734
100 Ga0307412_11067270 3300031911 Bacteria 717
101 Ga0307409_100046952 3300031995 Bacteria 3273
102 Ga0307409_100211280 3300031995 Bacteria 1744
103 Ga0307409_100546415 3300031995 Bacteria 1136
104 Ga0307414_10070609 3300032004 Bacteria 2515
105 Ga0307414_10075906 3300032004 Bacteria 2441
106 Ga0307414_10232622 3300032004 Bacteria 1520
107 Ga0307411_10017131 3300032005 Bacteria 4117
108 Ga0307415_100371605 3300032126 Bacteria 1211
109 Ga0373937_0508405 3300036401 Bacteria 1145
110 Ga0395900_0191753 3300037418 Bacteria 2073
111 Ga0436361_0031129 3300039447 Bacteria 3653
112 Ga0436361_0206755 3300039447 Bacteria 21611
113 Ga0436361_0502059 3300039447 Bacteria 2309
114 Ga0436361_0948778 3300039447 Bacteria 1003
115 Ga0439465_0194309 3300041413 Bacteria 738
116 Ga0450910_028561 3300042147 Bacteria 868
117 Ga0439459_0043065 3300042438 Bacteria 966
118 Ga0466971_0047930 3300044719 Bacteria 1921
119 Ga0466957_0009411 3300044842 Bacteria 5579
120 Ga0466959_0074481 3300045049 Bacteria 2455
121 Ga0466958_0000190 3300045836 Bacteria 22413
122 Ga0495623_0272118 3300046679 Bacteria 945
123 Ga0495600_0264466 3300046809 Bacteria 1092
124 Ga0496104_0855731 3300048907 Bacteria 815
125 Ga0496110_0552154 3300048913 Bacteria 1047
126 Ga0496111_0070056 3300048914 Bacteria 2550
127 Ga0496112_0509793 3300048915 Bacteria 1138
128 Ga0496124_0134755 3300048927 Bacteria 1957
129 Ga0496124_0164567 3300048927 Bacteria 1725
130 Ga0496124_0209459 3300048927 Bacteria 1476
131 Ga0496125_0000115 3300048928 Bacteria 181994
132 Ga0501033_0035431 3300049570 Bacteria 3742
133 Ga0501034_0000815 3300049571 Bacteria 46393
134 Ga0501034_0274249 3300049571 Bacteria 1627
135 Ga0501037_0302491 3300049573 Bacteria 1110
136 Ga0501038_0781369 3300049574 Bacteria 711
137 Ga0501039_0200908 3300049575 Bacteria 1567
138 Ga0501040_0560609 3300049576 Bacteria 825
139 Ga0501041_0169353 3300049577 Bacteria 1367
140 Ga0501043_0187749 3300049579 Bacteria 1608
141 Ga0501046_0000010 3300049580 Bacteria 331082
142 Ga0501046_0131505 3300049580 Bacteria 1898
143 Ga0501047_0165058 3300049581 Bacteria 2085
144 Ga0501070_0114288 3300049586 Bacteria 2230
145 Ga0501073_0396979 3300049589 Bacteria 953
146 Ga0501079_0828122 3300049741 Bacteria 729
147 Ga0501035_0013258 3300049822 Bacteria 7605
148 Ga0501035_0347632 3300049822 Bacteria 1241
149 Ga0501044_0159401 3300049823 Bacteria 2234
150 Ga0501044_0160274 3300049823 Bacteria 2227
151 Ga0501044_0334872 3300049823 Bacteria 1435
152 nmdc:mga05p37_154_c1 3300050507 Bacteria 65419
153 nmdc:mga09592_36_c3 3300050508 Bacteria 51356
154 nmdc:mga0qj67_1029_c1 3300050509 Bacteria 19287
155 nmdc:mga0qj67_321847_c1 3300050509 Bacteria 1252
156 nmdc:mga0qj67_42_c1 3300050509 Bacteria 46863
157 nmdc:mga06r32_1638_c1 3300050510 Bacteria 15008
158 nmdc:mga08y16_204935_c1 3300050511 Bacteria 2044
159 nmdc:mga08y16_389071_c1 3300050511 Bacteria 1429
160 nmdc:mga08y16_943104_c1 3300050511 Bacteria 846
161 nmdc:mga0a205_261328_c1 3300050515 Bacteria 1609
162 Ga0500604_0000313 3300053151 Bacteria 13494
163 Ga0500616_0068393 3300053153 Bacteria 1819
164 Ga0500634_0230215 3300053161 Bacteria 787

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0552154 Ga0496110_0552154_21_596 172
2 3300049577 Ga0501041_0169353 Ga0501041_0169353_13_537 174
3 3300006237 Ga0097621_100314904 Ga0097621_1003149042 180
4 3300025961 Ga0207712_10174512 Ga0207712_101745122 181
5 3300049741 Ga0501079_0828122 Ga0501079_0828122_126_689 187
6 3300005457 Ga0070662_100879940 Ga0070662_1008799402 192
7 3300013296 Ga0157374_10006115 Ga0157374_1000611515 195
8 3300049574 Ga0501038_0781369 Ga0501038_0781369_17_622 195
9 3300042147 Ga0450910_028561 Ga0450910_028561_42_635 197
10 3300005578 Ga0068854_100474730 Ga0068854_1004747302 200
11 3300025932 Ga0207690_10619403 Ga0207690_106194032 200
12 3300049589 Ga0501073_0396979 Ga0501073_0396979_294_941 202
13 3300031824 Ga0307413_10102023 Ga0307413_101020232 203
14 3300031852 Ga0307410_10048798 Ga0307410_100487981 203
15 3300031903 Ga0307407_10035665 Ga0307407_100356653 203
16 3300031995 Ga0307409_100211280 Ga0307409_1002112802 203
17 3300032005 Ga0307411_10017131 Ga0307411_100171312 203
18 3300006237 Ga0097621_100042211 Ga0097621_1000422114 205
19 3300006358 Ga0068871_100018440 Ga0068871_1000184407 205
20 3300042438 Ga0439459_0043065 Ga0439459_0043065_197_868 206
21 3300021361 Ga0213872_10000806 Ga0213872_100008069 210
22 3300021361 Ga0213872_10061080 Ga0213872_100610802 210
23 3300028577 Ga0265318_10054918 Ga0265318_100549182 210
24 3300031995 Ga0307409_100046952 Ga0307409_1000469523 210
25 3300039447 Ga0436361_0031129 Ga0436361_0031129_1433_2068 210
26 3300039447 Ga0436361_0206755 Ga0436361_0206755_6395_7030 210
27 3300045049 Ga0466959_0074481 Ga0466959_0074481_101_736 210
28 3300039447 Ga0436361_0502059 Ga0436361_0502059_183_821 211
29 3300039447 Ga0436361_0948778 Ga0436361_0948778_263_901 211
30 3300044719 Ga0466971_0047930 Ga0466971_0047930_537_1175 211
31 3300044842 Ga0466957_0009411 Ga0466957_0009411_2540_3178 211
32 3300045836 Ga0466958_0000190 Ga0466958_0000190_10916_11554 211
33 3300032126 Ga0307415_100371605 Ga0307415_1003716052 213
34 iso_pu_bacteria 2643221580 2643912014 214
35 iso_pu_bacteria 2643221674 2644412812 214
36 iso_pu_bacteria 2932401849 2932405153 214
37 3300005331 Ga0070670_100617590 Ga0070670_1006175902 215
38 3300005563 Ga0068855_100014993 Ga0068855_1000149937 215
39 3300005578 Ga0068854_100000327 Ga0068854_10000032722 215
40 3300006852 Ga0075433_10268637 Ga0075433_102686371 215
41 3300009093 Ga0105240_10044695 Ga0105240_100446952 215
42 3300025913 Ga0207695_10025083 Ga0207695_100250837 215
43 3300025949 Ga0207667_10001299 Ga0207667_1000129922 215
44 3300025981 Ga0207640_10000313 Ga0207640_1000031315 215
45 3300050515 nmdc:mga0a205_261328_c1 nmdc:mga0a205_261328_c1_735_1382 215
46 3300005548 Ga0070665_100182695 Ga0070665_1001826952 216
47 3300009094 Ga0111539_10340465 Ga0111539_103404652 216
48 iso_pu_bacteria 2671180139 2671693922 216
49 3300005345 Ga0070692_10216726 Ga0070692_102167262 217
50 3300009094 Ga0111539_10878018 Ga0111539_108780183 217
51 3300028800 Ga0265338_10351679 Ga0265338_103516792 217
52 3300036401 Ga0373937_0508405 Ga0373937_0508405_58_711 217
53 3300049573 Ga0501037_0302491 Ga0501037_0302491_244_897 217
54 3300049575 Ga0501039_0200908 Ga0501039_0200908_71_724 217
55 3300005337 Ga0070682_100470983 Ga0070682_1004709832 218
56 3300005455 Ga0070663_100186811 Ga0070663_1001868113 218
57 3300006846 Ga0075430_100009492 Ga0075430_1000094928 218
58 3300025231 Ga0207427_101083 Ga0207427_1010833 218
59 3300025261 Ga0209233_1000176 Ga0209233_10001763 218
60 3300025924 Ga0207694_10587660 Ga0207694_105876601 218
61 3300025942 Ga0207689_10395613 Ga0207689_103956132 218
62 3300025945 Ga0207679_10216392 Ga0207679_102163923 218
63 3300026067 Ga0207678_10207826 Ga0207678_102078263 218
64 3300027876 Ga0209974_10084100 Ga0209974_100841001 218
65 3300031251 Ga0265327_10020118 Ga0265327_100201186 218
66 3300031548 Ga0307408_100222207 Ga0307408_1002222072 218
67 3300031911 Ga0307412_11067270 Ga0307412_110672701 218
68 3300031995 Ga0307409_100546415 Ga0307409_1005464152 218
69 3300032004 Ga0307414_10070609 Ga0307414_100706093 218
70 3300032004 Ga0307414_10075906 Ga0307414_100759062 218
71 3300032004 Ga0307414_10232622 Ga0307414_102326222 218
72 3300037418 Ga0395900_0191753 Ga0395900_0191753_523_1182 218
73 3300041413 Ga0439465_0194309 Ga0439465_0194309_12_671 218
74 3300046679 Ga0495623_0272118 Ga0495623_0272118_40_747 218
75 3300046809 Ga0495600_0264466 Ga0495600_0264466_19_813 218
76 3300048914 Ga0496111_0070056 Ga0496111_0070056_1742_2419 218
77 3300048927 Ga0496124_0134755 Ga0496124_0134755_453_1109 218
78 3300048927 Ga0496124_0164567 Ga0496124_0164567_404_1063 218
79 3300048927 Ga0496124_0209459 Ga0496124_0209459_303_980 218
80 3300048928 Ga0496125_0000115 Ga0496125_0000115_14909_15586 218
81 3300049570 Ga0501033_0035431 Ga0501033_0035431_2141_2815 218
82 3300049571 Ga0501034_0000815 Ga0501034_0000815_657_1316 218
83 3300049571 Ga0501034_0274249 Ga0501034_0274249_267_926 218
84 3300049576 Ga0501040_0560609 Ga0501040_0560609_117_776 218
85 3300049579 Ga0501043_0187749 Ga0501043_0187749_185_859 218
86 3300049580 Ga0501046_0000010 Ga0501046_0000010_5653_6312 218
87 3300049580 Ga0501046_0131505 Ga0501046_0131505_817_1491 218
88 3300049581 Ga0501047_0165058 Ga0501047_0165058_1253_1927 218
89 3300049586 Ga0501070_0114288 Ga0501070_0114288_1517_2191 218
90 3300049822 Ga0501035_0013258 Ga0501035_0013258_4314_4988 218
91 3300049822 Ga0501035_0347632 Ga0501035_0347632_21_680 218
92 3300049823 Ga0501044_0159401 Ga0501044_0159401_513_1187 218
93 3300049823 Ga0501044_0160274 Ga0501044_0160274_744_1409 218
94 3300049823 Ga0501044_0334872 Ga0501044_0334872_629_1303 218
95 3300050509 nmdc:mga0qj67_1029_c1 nmdc:mga0qj67_1029_c1_7039_7695 218
96 3300050509 nmdc:mga0qj67_321847_c1 nmdc:mga0qj67_321847_c1_247_906 218
97 3300050511 nmdc:mga08y16_204935_c1 nmdc:mga08y16_204935_c1_219_884 218
98 3300050511 nmdc:mga08y16_943104_c1 nmdc:mga08y16_943104_c1_111_770 218
99 3300053151 Ga0500604_0000313 Ga0500604_0000313_1187_1843 218
100 3300053153 Ga0500616_0068393 Ga0500616_0068393_587_1249 218
101 3300053161 Ga0500634_0230215 Ga0500634_0230215_80_742 218
102 3300005327 Ga0070658_10051963 Ga0070658_100519634 220
103 3300005329 Ga0070683_100274267 Ga0070683_1002742673 220
104 3300005331 Ga0070670_100109358 Ga0070670_1001093582 220
105 3300005334 Ga0068869_100643282 Ga0068869_1006432821 220
106 3300005338 Ga0068868_100001291 Ga0068868_10000129111 220
107 3300005339 Ga0070660_100616387 Ga0070660_1006163871 220
108 3300005344 Ga0070661_100015942 Ga0070661_1000159424 220
109 3300005344 Ga0070661_100080197 Ga0070661_1000801972 220
110 3300005345 Ga0070692_10068849 Ga0070692_100688493 220
111 3300005354 Ga0070675_100039863 Ga0070675_1000398631 220
112 3300005366 Ga0070659_100009753 Ga0070659_1000097534 220
113 3300005441 Ga0070700_100007407 Ga0070700_1000074074 220
114 3300005444 Ga0070694_100764565 Ga0070694_1007645651 220
115 3300005455 Ga0070663_100011906 Ga0070663_1000119064 220
116 3300005457 Ga0070662_100082846 Ga0070662_1000828464 220
117 3300005530 Ga0070679_100028162 Ga0070679_1000281623 220
118 3300005535 Ga0070684_100038238 Ga0070684_1000382383 220
119 3300005564 Ga0070664_100018458 Ga0070664_1000184584 220
120 3300005564 Ga0070664_100242063 Ga0070664_1002420633 220
121 3300005577 Ga0068857_100080430 Ga0068857_1000804304 220
122 3300005577 Ga0068857_100178610 Ga0068857_1001786102 220
123 3300005615 Ga0070702_100078260 Ga0070702_1000782602 220
124 3300005616 Ga0068852_100293917 Ga0068852_1002939172 220
125 3300005719 Ga0068861_100039166 Ga0068861_1000391662 220
126 3300005841 Ga0068863_101230857 Ga0068863_1012308571 220
127 3300005843 Ga0068860_100098703 Ga0068860_1000987034 220
128 3300005844 Ga0068862_100117548 Ga0068862_1001175483 220
129 3300006844 Ga0075428_100023876 Ga0075428_1000238762 220
130 3300006846 Ga0075430_100021851 Ga0075430_1000218512 220
131 3300006880 Ga0075429_100125093 Ga0075429_1001250933 220
132 3300009094 Ga0111539_10022434 Ga0111539_100224341 220
133 3300009147 Ga0114129_10000085 Ga0114129_100000856 220
134 3300009553 Ga0105249_11080330 Ga0105249_110803302 220
135 3300010375 Ga0105239_10354866 Ga0105239_103548663 220
136 3300013104 Ga0157370_10177831 Ga0157370_101778313 220
137 3300013307 Ga0157372_10773357 Ga0157372_107733572 220
138 3300020070 Ga0206356_10992787 Ga0206356_109927871 220
139 3300020077 Ga0206351_10472023 Ga0206351_104720231 220
140 3300020082 Ga0206353_10266825 Ga0206353_102668252 220
141 3300025908 Ga0207643_10559647 Ga0207643_105596471 220
142 3300025909 Ga0207705_10134891 Ga0207705_101348911 220
143 3300025918 Ga0207662_10675464 Ga0207662_106754641 220
144 3300025921 Ga0207652_10027419 Ga0207652_100274194 220
145 3300025926 Ga0207659_10010085 Ga0207659_100100853 220
146 3300025932 Ga0207690_10183900 Ga0207690_101839003 220
147 3300025933 Ga0207706_10148830 Ga0207706_101488301 220
148 3300025942 Ga0207689_10019011 Ga0207689_100190115 220
149 3300025944 Ga0207661_10001872 Ga0207661_1000187213 220
150 3300025944 Ga0207661_10195348 Ga0207661_101953482 220
151 3300025945 Ga0207679_10235879 Ga0207679_102358793 220
152 3300026023 Ga0207677_10055292 Ga0207677_100552923 220
153 3300026067 Ga0207678_10011611 Ga0207678_100116115 220
154 3300026075 Ga0207708_10000673 Ga0207708_100006734 220
155 3300026116 Ga0207674_10006524 Ga0207674_100065244 220
156 3300026116 Ga0207674_10040434 Ga0207674_100404344 220
157 3300026118 Ga0207675_100052613 Ga0207675_1000526133 220
158 3300026142 Ga0207698_10491563 Ga0207698_104915632 220
159 3300027907 Ga0207428_10048815 Ga0207428_100488153 220
160 3300028380 Ga0268265_10171168 Ga0268265_101711682 220
161 3300028381 Ga0268264_10477644 Ga0268264_104776442 220
162 3300048907 Ga0496104_0855731 Ga0496104_0855731_70_732 220
163 3300048915 Ga0496112_0509793 Ga0496112_0509793_260_922 220
164 3300050507 nmdc:mga05p37_154_c1 nmdc:mga05p37_154_c1_17836_18498 220
165 3300050508 nmdc:mga09592_36_c3 nmdc:mga09592_36_c3_17784_18446 220
166 3300050509 nmdc:mga0qj67_42_c1 nmdc:mga0qj67_42_c1_12824_13486 220
167 3300050510 nmdc:mga06r32_1638_c1 nmdc:mga06r32_1638_c1_1523_2185 220
168 3300050511 nmdc:mga08y16_389071_c1 nmdc:mga08y16_389071_c1_126_794 220

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

48

205

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9738 9 195
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9674 10 194
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9623 10 194
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9537 9 195
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9523 12 212
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9677 46 193 3.30.1060.10
af_Q9SL43_48_247_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9671 45 196 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9574 44 199 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9528 38 197 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9503 7 197 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1G0KCH0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) 0.9926 35 184 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A851U892-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9872 6 157 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A1A7ZSG0-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9867 3 157 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A7L0WSM5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9863 10 150 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A674JX44-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9861 28 177 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Feature Viewer

pLDDT pTM Quality
86.85 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map