F253344
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 168 | 131 | 164 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300046679|Ga0495623_0272118|Ga0495623_0272118_40_747 |
| Length | 235 |
| Sequence | VFGLSSKKTLPTPDDALTGRPEPLPGIPTTHEVLGTPLHGPWPEGTRVLYVAMGCFWGAERIFWKLPGVVTTAAGYMGGLTPNATYEEVCSGRTGHTEAVLVAYDPAVTSAETLLAAFWENHDPTQGFRQGNDVGSQYRSAIYWTTPEQEQAARATRAAFQDVLHAHGFGEITTELRPAQEAGEFYYAEDYHQQYLHKNPGGYCNHGPNGMTCPVGLVPQNELPSQTSVLPPTAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 2 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 3 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 4 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 27 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 33 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 51 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 52 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 81 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 82 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 83 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 84 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 85 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 87 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 88 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 89 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 90 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 91 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 92 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 93 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 94 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 95 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 96 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 97 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 98 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 99 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 100 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 103 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 104 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 105 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 106 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 107 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 108 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 109 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 112 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 121 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 124 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 125 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 130 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 131 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.83 |
| Metatranscriptomes | 1.79 |
| Isolates | 2.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.98 |
| Nodule | 0 |
| Rhizoplane | 2.38 |
| Rhizosphere | 90.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10051963 | 3300005327 | Bacteria | 3322 |
| 2 | Ga0070683_100274267 | 3300005329 | Bacteria | 1604 |
| 3 | Ga0070670_100109358 | 3300005331 | Bacteria | 2382 |
| 4 | Ga0070670_100617590 | 3300005331 | Bacteria | 971 |
| 5 | Ga0068869_100643282 | 3300005334 | Bacteria | 899 |
| 6 | Ga0070682_100470983 | 3300005337 | Bacteria | 967 |
| 7 | Ga0068868_100001291 | 3300005338 | Bacteria | 17250 |
| 8 | Ga0070660_100616387 | 3300005339 | Bacteria | 908 |
| 9 | Ga0070661_100015942 | 3300005344 | Bacteria | 5304 |
| 10 | Ga0070661_100080197 | 3300005344 | Bacteria | 2409 |
| 11 | Ga0070692_10068849 | 3300005345 | Bacteria | 1881 |
| 12 | Ga0070692_10216726 | 3300005345 | Bacteria | 1129 |
| 13 | Ga0070675_100039863 | 3300005354 | Bacteria | 3834 |
| 14 | Ga0070659_100009753 | 3300005366 | Bacteria | 7057 |
| 15 | Ga0070700_100007407 | 3300005441 | Bacteria | 5924 |
| 16 | Ga0070694_100764565 | 3300005444 | Bacteria | 790 |
| 17 | Ga0070663_100011906 | 3300005455 | Bacteria | 5485 |
| 18 | Ga0070663_100186811 | 3300005455 | Bacteria | 1611 |
| 19 | Ga0070662_100082846 | 3300005457 | Bacteria | 2393 |
| 20 | Ga0070662_100879940 | 3300005457 | Bacteria | 764 |
| 21 | Ga0070679_100028162 | 3300005530 | Bacteria | 5537 |
| 22 | Ga0070684_100038238 | 3300005535 | Bacteria | 4121 |
| 23 | Ga0070665_100182695 | 3300005548 | Bacteria | 2098 |
| 24 | Ga0068855_100014993 | 3300005563 | Bacteria | 9334 |
| 25 | Ga0070664_100018458 | 3300005564 | Bacteria | 5731 |
| 26 | Ga0070664_100242063 | 3300005564 | Bacteria | 1620 |
| 27 | Ga0068857_100080430 | 3300005577 | Bacteria | 2910 |
| 28 | Ga0068857_100178610 | 3300005577 | Bacteria | 1931 |
| 29 | Ga0068854_100000327 | 3300005578 | Bacteria | 31304 |
| 30 | Ga0068854_100474730 | 3300005578 | Bacteria | 1049 |
| 31 | Ga0070702_100078260 | 3300005615 | Bacteria | 1973 |
| 32 | Ga0068852_100293917 | 3300005616 | Bacteria | 1570 |
| 33 | Ga0068861_100039166 | 3300005719 | Bacteria | 3536 |
| 34 | Ga0068863_101230857 | 3300005841 | Bacteria | 755 |
| 35 | Ga0068860_100098703 | 3300005843 | Bacteria | 2785 |
| 36 | Ga0068862_100117548 | 3300005844 | Bacteria | 2340 |
| 37 | Ga0097621_100042211 | 3300006237 | Bacteria | 3673 |
| 38 | Ga0097621_100314904 | 3300006237 | Bacteria | 1385 |
| 39 | Ga0068871_100018440 | 3300006358 | Bacteria | 5304 |
| 40 | Ga0075428_100023876 | 3300006844 | Bacteria | 6767 |
| 41 | Ga0075430_100009492 | 3300006846 | Bacteria | 8223 |
| 42 | Ga0075430_100021851 | 3300006846 | Bacteria | 5437 |
| 43 | Ga0075433_10268637 | 3300006852 | Bacteria | 1512 |
| 44 | Ga0075429_100125093 | 3300006880 | Bacteria | 2248 |
| 45 | Ga0105240_10044695 | 3300009093 | Bacteria | 5625 |
| 46 | Ga0111539_10022434 | 3300009094 | Bacteria | 7757 |
| 47 | Ga0111539_10340465 | 3300009094 | Bacteria | 1746 |
| 48 | Ga0111539_10878018 | 3300009094 | Bacteria | 1043 |
| 49 | Ga0114129_10000085 | 3300009147 | Bacteria | 86976 |
| 50 | Ga0105249_11080330 | 3300009553 | Bacteria | 872 |
| 51 | Ga0105239_10354866 | 3300010375 | Bacteria | 1656 |
| 52 | Ga0157370_10177831 | 3300013104 | Bacteria | 1978 |
| 53 | Ga0157374_10006115 | 3300013296 | Bacteria | 10193 |
| 54 | Ga0157372_10773357 | 3300013307 | Bacteria | 1116 |
| 55 | Ga0206356_10992787 | 3300020070 | Bacteria | 1111 |
| 56 | Ga0206351_10472023 | 3300020077 | Bacteria | 710 |
| 57 | Ga0206353_10266825 | 3300020082 | Bacteria | 1134 |
| 58 | Ga0213872_10000806 | 3300021361 | Bacteria | 22739 |
| 59 | Ga0213872_10061080 | 3300021361 | Bacteria | 1704 |
| 60 | Ga0207427_101083 | 3300025231 | Bacteria | 11132 |
| 61 | Ga0209233_1000176 | 3300025261 | Bacteria | 142863 |
| 62 | Ga0207643_10559647 | 3300025908 | Bacteria | 734 |
| 63 | Ga0207705_10134891 | 3300025909 | Bacteria | 1839 |
| 64 | Ga0207695_10025083 | 3300025913 | Bacteria | 6687 |
| 65 | Ga0207662_10675464 | 3300025918 | Bacteria | 723 |
| 66 | Ga0207652_10027419 | 3300025921 | Bacteria | 4747 |
| 67 | Ga0207694_10587660 | 3300025924 | Bacteria | 936 |
| 68 | Ga0207659_10010085 | 3300025926 | Bacteria | 5920 |
| 69 | Ga0207690_10183900 | 3300025932 | Bacteria | 1576 |
| 70 | Ga0207690_10619403 | 3300025932 | Bacteria | 885 |
| 71 | Ga0207706_10148830 | 3300025933 | Bacteria | 2060 |
| 72 | Ga0207689_10019011 | 3300025942 | Bacteria | 5795 |
| 73 | Ga0207689_10395613 | 3300025942 | Bacteria | 1152 |
| 74 | Ga0207661_10001872 | 3300025944 | Bacteria | 14421 |
| 75 | Ga0207661_10195348 | 3300025944 | Bacteria | 1776 |
| 76 | Ga0207679_10216392 | 3300025945 | Bacteria | 1610 |
| 77 | Ga0207679_10235879 | 3300025945 | Bacteria | 1547 |
| 78 | Ga0207667_10001299 | 3300025949 | Bacteria | 31318 |
| 79 | Ga0207712_10174512 | 3300025961 | Bacteria | 1683 |
| 80 | Ga0207640_10000313 | 3300025981 | Bacteria | 32457 |
| 81 | Ga0207677_10055292 | 3300026023 | Bacteria | 2713 |
| 82 | Ga0207678_10011611 | 3300026067 | Bacteria | 7738 |
| 83 | Ga0207678_10207826 | 3300026067 | Bacteria | 1674 |
| 84 | Ga0207708_10000673 | 3300026075 | Bacteria | 26177 |
| 85 | Ga0207674_10006524 | 3300026116 | Bacteria | 13715 |
| 86 | Ga0207674_10040434 | 3300026116 | Bacteria | 4829 |
| 87 | Ga0207675_100052613 | 3300026118 | Bacteria | 3800 |
| 88 | Ga0207698_10491563 | 3300026142 | Bacteria | 1192 |
| 89 | Ga0209974_10084100 | 3300027876 | Bacteria | 1098 |
| 90 | Ga0207428_10048815 | 3300027907 | Bacteria | 3394 |
| 91 | Ga0268265_10171168 | 3300028380 | Bacteria | 1856 |
| 92 | Ga0268264_10477644 | 3300028381 | Bacteria | 1212 |
| 93 | Ga0265318_10054918 | 3300028577 | Bacteria | 1492 |
| 94 | Ga0265338_10351679 | 3300028800 | Bacteria | 1059 |
| 95 | Ga0265327_10020118 | 3300031251 | Bacteria | 4079 |
| 96 | Ga0307408_100222207 | 3300031548 | Bacteria | 1542 |
| 97 | Ga0307413_10102023 | 3300031824 | Bacteria | 1898 |
| 98 | Ga0307410_10048798 | 3300031852 | Bacteria | 2838 |
| 99 | Ga0307407_10035665 | 3300031903 | Bacteria | 2734 |
| 100 | Ga0307412_11067270 | 3300031911 | Bacteria | 717 |
| 101 | Ga0307409_100046952 | 3300031995 | Bacteria | 3273 |
| 102 | Ga0307409_100211280 | 3300031995 | Bacteria | 1744 |
| 103 | Ga0307409_100546415 | 3300031995 | Bacteria | 1136 |
| 104 | Ga0307414_10070609 | 3300032004 | Bacteria | 2515 |
| 105 | Ga0307414_10075906 | 3300032004 | Bacteria | 2441 |
| 106 | Ga0307414_10232622 | 3300032004 | Bacteria | 1520 |
| 107 | Ga0307411_10017131 | 3300032005 | Bacteria | 4117 |
| 108 | Ga0307415_100371605 | 3300032126 | Bacteria | 1211 |
| 109 | Ga0373937_0508405 | 3300036401 | Bacteria | 1145 |
| 110 | Ga0395900_0191753 | 3300037418 | Bacteria | 2073 |
| 111 | Ga0436361_0031129 | 3300039447 | Bacteria | 3653 |
| 112 | Ga0436361_0206755 | 3300039447 | Bacteria | 21611 |
| 113 | Ga0436361_0502059 | 3300039447 | Bacteria | 2309 |
| 114 | Ga0436361_0948778 | 3300039447 | Bacteria | 1003 |
| 115 | Ga0439465_0194309 | 3300041413 | Bacteria | 738 |
| 116 | Ga0450910_028561 | 3300042147 | Bacteria | 868 |
| 117 | Ga0439459_0043065 | 3300042438 | Bacteria | 966 |
| 118 | Ga0466971_0047930 | 3300044719 | Bacteria | 1921 |
| 119 | Ga0466957_0009411 | 3300044842 | Bacteria | 5579 |
| 120 | Ga0466959_0074481 | 3300045049 | Bacteria | 2455 |
| 121 | Ga0466958_0000190 | 3300045836 | Bacteria | 22413 |
| 122 | Ga0495623_0272118 | 3300046679 | Bacteria | 945 |
| 123 | Ga0495600_0264466 | 3300046809 | Bacteria | 1092 |
| 124 | Ga0496104_0855731 | 3300048907 | Bacteria | 815 |
| 125 | Ga0496110_0552154 | 3300048913 | Bacteria | 1047 |
| 126 | Ga0496111_0070056 | 3300048914 | Bacteria | 2550 |
| 127 | Ga0496112_0509793 | 3300048915 | Bacteria | 1138 |
| 128 | Ga0496124_0134755 | 3300048927 | Bacteria | 1957 |
| 129 | Ga0496124_0164567 | 3300048927 | Bacteria | 1725 |
| 130 | Ga0496124_0209459 | 3300048927 | Bacteria | 1476 |
| 131 | Ga0496125_0000115 | 3300048928 | Bacteria | 181994 |
| 132 | Ga0501033_0035431 | 3300049570 | Bacteria | 3742 |
| 133 | Ga0501034_0000815 | 3300049571 | Bacteria | 46393 |
| 134 | Ga0501034_0274249 | 3300049571 | Bacteria | 1627 |
| 135 | Ga0501037_0302491 | 3300049573 | Bacteria | 1110 |
| 136 | Ga0501038_0781369 | 3300049574 | Bacteria | 711 |
| 137 | Ga0501039_0200908 | 3300049575 | Bacteria | 1567 |
| 138 | Ga0501040_0560609 | 3300049576 | Bacteria | 825 |
| 139 | Ga0501041_0169353 | 3300049577 | Bacteria | 1367 |
| 140 | Ga0501043_0187749 | 3300049579 | Bacteria | 1608 |
| 141 | Ga0501046_0000010 | 3300049580 | Bacteria | 331082 |
| 142 | Ga0501046_0131505 | 3300049580 | Bacteria | 1898 |
| 143 | Ga0501047_0165058 | 3300049581 | Bacteria | 2085 |
| 144 | Ga0501070_0114288 | 3300049586 | Bacteria | 2230 |
| 145 | Ga0501073_0396979 | 3300049589 | Bacteria | 953 |
| 146 | Ga0501079_0828122 | 3300049741 | Bacteria | 729 |
| 147 | Ga0501035_0013258 | 3300049822 | Bacteria | 7605 |
| 148 | Ga0501035_0347632 | 3300049822 | Bacteria | 1241 |
| 149 | Ga0501044_0159401 | 3300049823 | Bacteria | 2234 |
| 150 | Ga0501044_0160274 | 3300049823 | Bacteria | 2227 |
| 151 | Ga0501044_0334872 | 3300049823 | Bacteria | 1435 |
| 152 | nmdc:mga05p37_154_c1 | 3300050507 | Bacteria | 65419 |
| 153 | nmdc:mga09592_36_c3 | 3300050508 | Bacteria | 51356 |
| 154 | nmdc:mga0qj67_1029_c1 | 3300050509 | Bacteria | 19287 |
| 155 | nmdc:mga0qj67_321847_c1 | 3300050509 | Bacteria | 1252 |
| 156 | nmdc:mga0qj67_42_c1 | 3300050509 | Bacteria | 46863 |
| 157 | nmdc:mga06r32_1638_c1 | 3300050510 | Bacteria | 15008 |
| 158 | nmdc:mga08y16_204935_c1 | 3300050511 | Bacteria | 2044 |
| 159 | nmdc:mga08y16_389071_c1 | 3300050511 | Bacteria | 1429 |
| 160 | nmdc:mga08y16_943104_c1 | 3300050511 | Bacteria | 846 |
| 161 | nmdc:mga0a205_261328_c1 | 3300050515 | Bacteria | 1609 |
| 162 | Ga0500604_0000313 | 3300053151 | Bacteria | 13494 |
| 163 | Ga0500616_0068393 | 3300053153 | Bacteria | 1819 |
| 164 | Ga0500634_0230215 | 3300053161 | Bacteria | 787 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0552154 | Ga0496110_0552154_21_596 | 172 |
| 2 | 3300049577 | Ga0501041_0169353 | Ga0501041_0169353_13_537 | 174 |
| 3 | 3300006237 | Ga0097621_100314904 | Ga0097621_1003149042 | 180 |
| 4 | 3300025961 | Ga0207712_10174512 | Ga0207712_101745122 | 181 |
| 5 | 3300049741 | Ga0501079_0828122 | Ga0501079_0828122_126_689 | 187 |
| 6 | 3300005457 | Ga0070662_100879940 | Ga0070662_1008799402 | 192 |
| 7 | 3300013296 | Ga0157374_10006115 | Ga0157374_1000611515 | 195 |
| 8 | 3300049574 | Ga0501038_0781369 | Ga0501038_0781369_17_622 | 195 |
| 9 | 3300042147 | Ga0450910_028561 | Ga0450910_028561_42_635 | 197 |
| 10 | 3300005578 | Ga0068854_100474730 | Ga0068854_1004747302 | 200 |
| 11 | 3300025932 | Ga0207690_10619403 | Ga0207690_106194032 | 200 |
| 12 | 3300049589 | Ga0501073_0396979 | Ga0501073_0396979_294_941 | 202 |
| 13 | 3300031824 | Ga0307413_10102023 | Ga0307413_101020232 | 203 |
| 14 | 3300031852 | Ga0307410_10048798 | Ga0307410_100487981 | 203 |
| 15 | 3300031903 | Ga0307407_10035665 | Ga0307407_100356653 | 203 |
| 16 | 3300031995 | Ga0307409_100211280 | Ga0307409_1002112802 | 203 |
| 17 | 3300032005 | Ga0307411_10017131 | Ga0307411_100171312 | 203 |
| 18 | 3300006237 | Ga0097621_100042211 | Ga0097621_1000422114 | 205 |
| 19 | 3300006358 | Ga0068871_100018440 | Ga0068871_1000184407 | 205 |
| 20 | 3300042438 | Ga0439459_0043065 | Ga0439459_0043065_197_868 | 206 |
| 21 | 3300021361 | Ga0213872_10000806 | Ga0213872_100008069 | 210 |
| 22 | 3300021361 | Ga0213872_10061080 | Ga0213872_100610802 | 210 |
| 23 | 3300028577 | Ga0265318_10054918 | Ga0265318_100549182 | 210 |
| 24 | 3300031995 | Ga0307409_100046952 | Ga0307409_1000469523 | 210 |
| 25 | 3300039447 | Ga0436361_0031129 | Ga0436361_0031129_1433_2068 | 210 |
| 26 | 3300039447 | Ga0436361_0206755 | Ga0436361_0206755_6395_7030 | 210 |
| 27 | 3300045049 | Ga0466959_0074481 | Ga0466959_0074481_101_736 | 210 |
| 28 | 3300039447 | Ga0436361_0502059 | Ga0436361_0502059_183_821 | 211 |
| 29 | 3300039447 | Ga0436361_0948778 | Ga0436361_0948778_263_901 | 211 |
| 30 | 3300044719 | Ga0466971_0047930 | Ga0466971_0047930_537_1175 | 211 |
| 31 | 3300044842 | Ga0466957_0009411 | Ga0466957_0009411_2540_3178 | 211 |
| 32 | 3300045836 | Ga0466958_0000190 | Ga0466958_0000190_10916_11554 | 211 |
| 33 | 3300032126 | Ga0307415_100371605 | Ga0307415_1003716052 | 213 |
| 34 | iso_pu_bacteria | 2643221580 | 2643912014 | 214 |
| 35 | iso_pu_bacteria | 2643221674 | 2644412812 | 214 |
| 36 | iso_pu_bacteria | 2932401849 | 2932405153 | 214 |
| 37 | 3300005331 | Ga0070670_100617590 | Ga0070670_1006175902 | 215 |
| 38 | 3300005563 | Ga0068855_100014993 | Ga0068855_1000149937 | 215 |
| 39 | 3300005578 | Ga0068854_100000327 | Ga0068854_10000032722 | 215 |
| 40 | 3300006852 | Ga0075433_10268637 | Ga0075433_102686371 | 215 |
| 41 | 3300009093 | Ga0105240_10044695 | Ga0105240_100446952 | 215 |
| 42 | 3300025913 | Ga0207695_10025083 | Ga0207695_100250837 | 215 |
| 43 | 3300025949 | Ga0207667_10001299 | Ga0207667_1000129922 | 215 |
| 44 | 3300025981 | Ga0207640_10000313 | Ga0207640_1000031315 | 215 |
| 45 | 3300050515 | nmdc:mga0a205_261328_c1 | nmdc:mga0a205_261328_c1_735_1382 | 215 |
| 46 | 3300005548 | Ga0070665_100182695 | Ga0070665_1001826952 | 216 |
| 47 | 3300009094 | Ga0111539_10340465 | Ga0111539_103404652 | 216 |
| 48 | iso_pu_bacteria | 2671180139 | 2671693922 | 216 |
| 49 | 3300005345 | Ga0070692_10216726 | Ga0070692_102167262 | 217 |
| 50 | 3300009094 | Ga0111539_10878018 | Ga0111539_108780183 | 217 |
| 51 | 3300028800 | Ga0265338_10351679 | Ga0265338_103516792 | 217 |
| 52 | 3300036401 | Ga0373937_0508405 | Ga0373937_0508405_58_711 | 217 |
| 53 | 3300049573 | Ga0501037_0302491 | Ga0501037_0302491_244_897 | 217 |
| 54 | 3300049575 | Ga0501039_0200908 | Ga0501039_0200908_71_724 | 217 |
| 55 | 3300005337 | Ga0070682_100470983 | Ga0070682_1004709832 | 218 |
| 56 | 3300005455 | Ga0070663_100186811 | Ga0070663_1001868113 | 218 |
| 57 | 3300006846 | Ga0075430_100009492 | Ga0075430_1000094928 | 218 |
| 58 | 3300025231 | Ga0207427_101083 | Ga0207427_1010833 | 218 |
| 59 | 3300025261 | Ga0209233_1000176 | Ga0209233_10001763 | 218 |
| 60 | 3300025924 | Ga0207694_10587660 | Ga0207694_105876601 | 218 |
| 61 | 3300025942 | Ga0207689_10395613 | Ga0207689_103956132 | 218 |
| 62 | 3300025945 | Ga0207679_10216392 | Ga0207679_102163923 | 218 |
| 63 | 3300026067 | Ga0207678_10207826 | Ga0207678_102078263 | 218 |
| 64 | 3300027876 | Ga0209974_10084100 | Ga0209974_100841001 | 218 |
| 65 | 3300031251 | Ga0265327_10020118 | Ga0265327_100201186 | 218 |
| 66 | 3300031548 | Ga0307408_100222207 | Ga0307408_1002222072 | 218 |
| 67 | 3300031911 | Ga0307412_11067270 | Ga0307412_110672701 | 218 |
| 68 | 3300031995 | Ga0307409_100546415 | Ga0307409_1005464152 | 218 |
| 69 | 3300032004 | Ga0307414_10070609 | Ga0307414_100706093 | 218 |
| 70 | 3300032004 | Ga0307414_10075906 | Ga0307414_100759062 | 218 |
| 71 | 3300032004 | Ga0307414_10232622 | Ga0307414_102326222 | 218 |
| 72 | 3300037418 | Ga0395900_0191753 | Ga0395900_0191753_523_1182 | 218 |
| 73 | 3300041413 | Ga0439465_0194309 | Ga0439465_0194309_12_671 | 218 |
| 74 | 3300046679 | Ga0495623_0272118 | Ga0495623_0272118_40_747 | 218 |
| 75 | 3300046809 | Ga0495600_0264466 | Ga0495600_0264466_19_813 | 218 |
| 76 | 3300048914 | Ga0496111_0070056 | Ga0496111_0070056_1742_2419 | 218 |
| 77 | 3300048927 | Ga0496124_0134755 | Ga0496124_0134755_453_1109 | 218 |
| 78 | 3300048927 | Ga0496124_0164567 | Ga0496124_0164567_404_1063 | 218 |
| 79 | 3300048927 | Ga0496124_0209459 | Ga0496124_0209459_303_980 | 218 |
| 80 | 3300048928 | Ga0496125_0000115 | Ga0496125_0000115_14909_15586 | 218 |
| 81 | 3300049570 | Ga0501033_0035431 | Ga0501033_0035431_2141_2815 | 218 |
| 82 | 3300049571 | Ga0501034_0000815 | Ga0501034_0000815_657_1316 | 218 |
| 83 | 3300049571 | Ga0501034_0274249 | Ga0501034_0274249_267_926 | 218 |
| 84 | 3300049576 | Ga0501040_0560609 | Ga0501040_0560609_117_776 | 218 |
| 85 | 3300049579 | Ga0501043_0187749 | Ga0501043_0187749_185_859 | 218 |
| 86 | 3300049580 | Ga0501046_0000010 | Ga0501046_0000010_5653_6312 | 218 |
| 87 | 3300049580 | Ga0501046_0131505 | Ga0501046_0131505_817_1491 | 218 |
| 88 | 3300049581 | Ga0501047_0165058 | Ga0501047_0165058_1253_1927 | 218 |
| 89 | 3300049586 | Ga0501070_0114288 | Ga0501070_0114288_1517_2191 | 218 |
| 90 | 3300049822 | Ga0501035_0013258 | Ga0501035_0013258_4314_4988 | 218 |
| 91 | 3300049822 | Ga0501035_0347632 | Ga0501035_0347632_21_680 | 218 |
| 92 | 3300049823 | Ga0501044_0159401 | Ga0501044_0159401_513_1187 | 218 |
| 93 | 3300049823 | Ga0501044_0160274 | Ga0501044_0160274_744_1409 | 218 |
| 94 | 3300049823 | Ga0501044_0334872 | Ga0501044_0334872_629_1303 | 218 |
| 95 | 3300050509 | nmdc:mga0qj67_1029_c1 | nmdc:mga0qj67_1029_c1_7039_7695 | 218 |
| 96 | 3300050509 | nmdc:mga0qj67_321847_c1 | nmdc:mga0qj67_321847_c1_247_906 | 218 |
| 97 | 3300050511 | nmdc:mga08y16_204935_c1 | nmdc:mga08y16_204935_c1_219_884 | 218 |
| 98 | 3300050511 | nmdc:mga08y16_943104_c1 | nmdc:mga08y16_943104_c1_111_770 | 218 |
| 99 | 3300053151 | Ga0500604_0000313 | Ga0500604_0000313_1187_1843 | 218 |
| 100 | 3300053153 | Ga0500616_0068393 | Ga0500616_0068393_587_1249 | 218 |
| 101 | 3300053161 | Ga0500634_0230215 | Ga0500634_0230215_80_742 | 218 |
| 102 | 3300005327 | Ga0070658_10051963 | Ga0070658_100519634 | 220 |
| 103 | 3300005329 | Ga0070683_100274267 | Ga0070683_1002742673 | 220 |
| 104 | 3300005331 | Ga0070670_100109358 | Ga0070670_1001093582 | 220 |
| 105 | 3300005334 | Ga0068869_100643282 | Ga0068869_1006432821 | 220 |
| 106 | 3300005338 | Ga0068868_100001291 | Ga0068868_10000129111 | 220 |
| 107 | 3300005339 | Ga0070660_100616387 | Ga0070660_1006163871 | 220 |
| 108 | 3300005344 | Ga0070661_100015942 | Ga0070661_1000159424 | 220 |
| 109 | 3300005344 | Ga0070661_100080197 | Ga0070661_1000801972 | 220 |
| 110 | 3300005345 | Ga0070692_10068849 | Ga0070692_100688493 | 220 |
| 111 | 3300005354 | Ga0070675_100039863 | Ga0070675_1000398631 | 220 |
| 112 | 3300005366 | Ga0070659_100009753 | Ga0070659_1000097534 | 220 |
| 113 | 3300005441 | Ga0070700_100007407 | Ga0070700_1000074074 | 220 |
| 114 | 3300005444 | Ga0070694_100764565 | Ga0070694_1007645651 | 220 |
| 115 | 3300005455 | Ga0070663_100011906 | Ga0070663_1000119064 | 220 |
| 116 | 3300005457 | Ga0070662_100082846 | Ga0070662_1000828464 | 220 |
| 117 | 3300005530 | Ga0070679_100028162 | Ga0070679_1000281623 | 220 |
| 118 | 3300005535 | Ga0070684_100038238 | Ga0070684_1000382383 | 220 |
| 119 | 3300005564 | Ga0070664_100018458 | Ga0070664_1000184584 | 220 |
| 120 | 3300005564 | Ga0070664_100242063 | Ga0070664_1002420633 | 220 |
| 121 | 3300005577 | Ga0068857_100080430 | Ga0068857_1000804304 | 220 |
| 122 | 3300005577 | Ga0068857_100178610 | Ga0068857_1001786102 | 220 |
| 123 | 3300005615 | Ga0070702_100078260 | Ga0070702_1000782602 | 220 |
| 124 | 3300005616 | Ga0068852_100293917 | Ga0068852_1002939172 | 220 |
| 125 | 3300005719 | Ga0068861_100039166 | Ga0068861_1000391662 | 220 |
| 126 | 3300005841 | Ga0068863_101230857 | Ga0068863_1012308571 | 220 |
| 127 | 3300005843 | Ga0068860_100098703 | Ga0068860_1000987034 | 220 |
| 128 | 3300005844 | Ga0068862_100117548 | Ga0068862_1001175483 | 220 |
| 129 | 3300006844 | Ga0075428_100023876 | Ga0075428_1000238762 | 220 |
| 130 | 3300006846 | Ga0075430_100021851 | Ga0075430_1000218512 | 220 |
| 131 | 3300006880 | Ga0075429_100125093 | Ga0075429_1001250933 | 220 |
| 132 | 3300009094 | Ga0111539_10022434 | Ga0111539_100224341 | 220 |
| 133 | 3300009147 | Ga0114129_10000085 | Ga0114129_100000856 | 220 |
| 134 | 3300009553 | Ga0105249_11080330 | Ga0105249_110803302 | 220 |
| 135 | 3300010375 | Ga0105239_10354866 | Ga0105239_103548663 | 220 |
| 136 | 3300013104 | Ga0157370_10177831 | Ga0157370_101778313 | 220 |
| 137 | 3300013307 | Ga0157372_10773357 | Ga0157372_107733572 | 220 |
| 138 | 3300020070 | Ga0206356_10992787 | Ga0206356_109927871 | 220 |
| 139 | 3300020077 | Ga0206351_10472023 | Ga0206351_104720231 | 220 |
| 140 | 3300020082 | Ga0206353_10266825 | Ga0206353_102668252 | 220 |
| 141 | 3300025908 | Ga0207643_10559647 | Ga0207643_105596471 | 220 |
| 142 | 3300025909 | Ga0207705_10134891 | Ga0207705_101348911 | 220 |
| 143 | 3300025918 | Ga0207662_10675464 | Ga0207662_106754641 | 220 |
| 144 | 3300025921 | Ga0207652_10027419 | Ga0207652_100274194 | 220 |
| 145 | 3300025926 | Ga0207659_10010085 | Ga0207659_100100853 | 220 |
| 146 | 3300025932 | Ga0207690_10183900 | Ga0207690_101839003 | 220 |
| 147 | 3300025933 | Ga0207706_10148830 | Ga0207706_101488301 | 220 |
| 148 | 3300025942 | Ga0207689_10019011 | Ga0207689_100190115 | 220 |
| 149 | 3300025944 | Ga0207661_10001872 | Ga0207661_1000187213 | 220 |
| 150 | 3300025944 | Ga0207661_10195348 | Ga0207661_101953482 | 220 |
| 151 | 3300025945 | Ga0207679_10235879 | Ga0207679_102358793 | 220 |
| 152 | 3300026023 | Ga0207677_10055292 | Ga0207677_100552923 | 220 |
| 153 | 3300026067 | Ga0207678_10011611 | Ga0207678_100116115 | 220 |
| 154 | 3300026075 | Ga0207708_10000673 | Ga0207708_100006734 | 220 |
| 155 | 3300026116 | Ga0207674_10006524 | Ga0207674_100065244 | 220 |
| 156 | 3300026116 | Ga0207674_10040434 | Ga0207674_100404344 | 220 |
| 157 | 3300026118 | Ga0207675_100052613 | Ga0207675_1000526133 | 220 |
| 158 | 3300026142 | Ga0207698_10491563 | Ga0207698_104915632 | 220 |
| 159 | 3300027907 | Ga0207428_10048815 | Ga0207428_100488153 | 220 |
| 160 | 3300028380 | Ga0268265_10171168 | Ga0268265_101711682 | 220 |
| 161 | 3300028381 | Ga0268264_10477644 | Ga0268264_104776442 | 220 |
| 162 | 3300048907 | Ga0496104_0855731 | Ga0496104_0855731_70_732 | 220 |
| 163 | 3300048915 | Ga0496112_0509793 | Ga0496112_0509793_260_922 | 220 |
| 164 | 3300050507 | nmdc:mga05p37_154_c1 | nmdc:mga05p37_154_c1_17836_18498 | 220 |
| 165 | 3300050508 | nmdc:mga09592_36_c3 | nmdc:mga09592_36_c3_17784_18446 | 220 |
| 166 | 3300050509 | nmdc:mga0qj67_42_c1 | nmdc:mga0qj67_42_c1_12824_13486 | 220 |
| 167 | 3300050510 | nmdc:mga06r32_1638_c1 | nmdc:mga06r32_1638_c1_1523_2185 | 220 |
| 168 | 3300050511 | nmdc:mga08y16_389071_c1 | nmdc:mga08y16_389071_c1_126_794 | 220 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6agv-assembly1.cif.gz_A | crystal structure of apo mouse msra | 0.9738 | 9 | 195 |
| 1ff3-assembly3.cif.gz_C | structure of the peptide methionine sulfoxide reductase from escherichia coli | 0.9674 | 10 | 194 |
| 1ff3-assembly3.cif.gz_C | structure of the peptide methionine sulfoxide reductase from escherichia coli | 0.9623 | 10 | 194 |
| 6agv-assembly1.cif.gz_A | crystal structure of apo mouse msra | 0.9537 | 9 | 195 |
| 1fva-assembly2.cif.gz_B | crystal structure of bovine methionine sulfoxide reductase | 0.9523 | 12 | 212 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9677 | 46 | 193 | 3.30.1060.10 |
| af_Q9SL43_48_247_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9671 | 45 | 196 | 3.30.1060.10 |
| af_P0A084_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9574 | 44 | 199 | 3.30.1060.10 |
| af_B6TNT5_14_185_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9528 | 38 | 197 | 3.30.1060.10 |
| 1ff3B00 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9503 | 7 | 197 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G0KCH0-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) | 0.9926 | 35 | 184 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A851U892-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) | 0.9872 | 6 | 157 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A1A7ZSG0-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) | 0.9867 | 3 | 157 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A7L0WSM5-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) | 0.9863 | 10 | 150 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
| AF-A0A674JX44-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) | 0.9861 | 28 | 177 |
GO:0005737
GO:0008113 GO:0034599 GO:0036456 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar