F253257

General Info

Members Datasets Scaffolds Average Seq Length
168 126 168 329

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0001699|Ga0495580_0001699_2644_3702
Length 352
Sequence MMPILIPSYLKRGQCPAMAERILVAGGAGYIGSVVVAQLLARGYEPVVYDDLSHGHGAALSPKVRLIVGDVGDRAALDRALSEVQPQAVMHFAAFIEAGESMQLPEKYFRNNTASALTLLEAVLAHKVSRFVFSSTAALYGTPEKTPIEETAPLHPTNAYGESKLLVEQMLDWLYRIHGQRYASLRYFNVAGAAGEQGEDHHPESHLIPLAFQAALGTRKELAIFGTDYPTPDGTCIRDYIHVSDLAAAHLLVLEALKEKDRLIYNLGNGQGFSVREVIETVRQVTGHPIPVKESPRRPGDPAVLVASSEKIKKQLGWQPNYPDLESIVRSAWDWRKAHANGYAPQESAPSC

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
64 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
89 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
113 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
114 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
115 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
116 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
117 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
118 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
119 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
120 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
123 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
124 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
125 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
126 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 0
Rhizoplane 2.38
Rhizosphere 89.29
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10090462 3300005295 Bacteria 4135
2 Ga0065707_10149779 3300005295 Bacteria 1672
3 Ga0068868_100075095 3300005338 Bacteria 2701
4 Ga0070709_10013861 3300005434 Bacteria 4545
5 Ga0070709_10054399 3300005434 Bacteria 2523
6 Ga0070713_100203998 3300005436 Bacteria 1787
7 Ga0070710_10048177 3300005437 Bacteria 2380
8 Ga0070708_100006946 3300005445 Bacteria 9030
9 Ga0070708_100077092 3300005445 Bacteria 3011
10 Ga0070708_100084550 3300005445 Bacteria 2878
11 Ga0070681_10111964 3300005458 Bacteria 2669
12 Ga0070706_100312563 3300005467 Bacteria 1466
13 Ga0070707_100218784 3300005468 Bacteria 1855
14 Ga0070698_100006061 3300005471 Bacteria 13166
15 Ga0070698_100010885 3300005471 Bacteria 9675
16 Ga0070698_100368167 3300005471 Bacteria 1369
17 Ga0070699_100123367 3300005518 Bacteria 2279
18 Ga0070684_100040980 3300005535 Bacteria 3990
19 Ga0070697_100001178 3300005536 Bacteria 19795
20 Ga0068853_100034450 3300005539 Bacteria 4298
21 Ga0070695_100152437 3300005545 Bacteria 1614
22 Ga0070693_100116706 3300005547 Bacteria 1650
23 Ga0070665_100003135 3300005548 Bacteria 17805
24 Ga0070704_100146336 3300005549 Bacteria 1852
25 Ga0068852_100052673 3300005616 Bacteria 3499
26 Ga0068863_100028997 3300005841 Bacteria 5286
27 Ga0068863_100216827 3300005841 Bacteria 1843
28 Ga0068860_100253406 3300005843 Bacteria 1715
29 Ga0070715_10105792 3300006163 Bacteria 1319
30 Ga0070716_100028848 3300006173 Bacteria 2994
31 Ga0070716_100211637 3300006173 Bacteria 1296
32 Ga0070712_100133641 3300006175 Bacteria 1883
33 Ga0070712_100145616 3300006175 Bacteria 1813
34 Ga0070712_100355018 3300006175 Bacteria 1201
35 Ga0097621_100091098 3300006237 Bacteria 2552
36 Ga0068871_100238410 3300006358 Bacteria 1580
37 Ga0075431_100002422 3300006847 Bacteria 17951
38 Ga0075431_100076829 3300006847 Unclassified 3446
39 Ga0075431_100100355 3300006847 Bacteria 2986
40 Ga0075433_10190460 3300006852 Bacteria 1825
41 Ga0075434_100007018 3300006871 Bacteria 10387
42 Ga0075434_100025711 3300006871 Bacteria 5762
43 Ga0075429_100064642 3300006880 Bacteria 3186
44 Ga0075435_100005989 3300007076 Bacteria 8557
45 Ga0099794_10018329 3300007265 Bacteria 3137
46 Ga0099794_10045891 3300007265 Bacteria 2091
47 Ga0099794_10069207 3300007265 Bacteria 1726
48 Ga0099795_10034946 3300007788 Bacteria 1754
49 Ga0114129_10015027 3300009147 Bacteria 11021
50 Ga0114129_10414849 3300009147 Unclassified 1772
51 Ga0105237_10109797 3300009545 Bacteria 2750
52 Ga0105238_10015738 3300009551 Bacteria 7659
53 Ga0105249_10460961 3300009553 Bacteria 1311
54 Ga0105239_10355353 3300010375 Bacteria 1654
55 Ga0105239_10684336 3300010375 Bacteria 1172
56 Ga0157369_10046202 3300013105 Unclassified 4733
57 Ga0157374_10087172 3300013296 Bacteria 2971
58 Ga0157378_10032645 3300013297 Bacteria 4600
59 Ga0157379_10114623 3300014968 Bacteria 2422
60 Ga0157379_10319923 3300014968 Bacteria 1416
61 Ga0157376_10000005 3300014969 Bacteria 443695
62 Ga0207699_10003765 3300025906 Bacteria 7241
63 Ga0207643_10117626 3300025908 Bacteria 1571
64 Ga0207684_10043451 3300025910 Bacteria 3810
65 Ga0207684_10210405 3300025910 Bacteria 1678
66 Ga0207693_10016050 3300025915 Bacteria 5993
67 Ga0207693_10023611 3300025915 Bacteria 4881
68 Ga0207693_10080363 3300025915 Bacteria 2552
69 Ga0207693_10148832 3300025915 Bacteria 1841
70 Ga0207663_10154440 3300025916 Bacteria 1613
71 Ga0207663_10156005 3300025916 Bacteria 1606
72 Ga0207646_10004491 3300025922 Bacteria 15127
73 Ga0207646_10073780 3300025922 Unclassified 3048
74 Ga0207646_10297126 3300025922 Bacteria 1459
75 Ga0207700_10026126 3300025928 Bacteria 4067
76 Ga0207664_10313363 3300025929 Bacteria 1383
77 Ga0207686_10193238 3300025934 Bacteria 1452
78 Ga0207665_10071443 3300025939 Bacteria 2370
79 Ga0207665_10075406 3300025939 Bacteria 2310
80 Ga0207665_10084088 3300025939 Bacteria 2196
81 Ga0207661_10004479 3300025944 Bacteria 9808
82 Ga0207677_10135983 3300026023 Bacteria 1874
83 Ga0207641_10001507 3300026088 Bacteria 22801
84 Ga0209588_1029058 3300027671 Bacteria 1762
85 Ga0268266_10002354 3300028379 Bacteria 20448
86 Ga0268264_10142219 3300028381 Bacteria 2141
87 Ga0265338_10214830 3300028800 Bacteria 1441
88 Ga0265340_10017552 3300031247 Bacteria 3702
89 Ga0265316_10000008 3300031344 Bacteria 261948
90 Ga0265316_10320418 3300031344 Bacteria 1126
91 Ga0316575_10018454 3300031665 Bacteria 2660
92 Ga0316579_10145218 3300031691 Bacteria 1144
93 Ga0316578_10113010 3300031728 Bacteria 1632
94 Ga0316577_10128500 3300031733 Unclassified 1426
95 Ga0316577_10151633 3300031733 Bacteria 1307
96 Ga0373926_0072369 3300035083 Bacteria 1268
97 Ga0316574_0015041 3300035398 Unclassified 4484
98 Ga0373937_0032891 3300036401 Bacteria 4705
99 Ga0373937_0131262 3300036401 Bacteria 2340
100 Ga0316582_0003335 3300036647 Bacteria 7848
101 Ga0316582_0063509 3300036647 Bacteria 2373
102 Ga0373925_0066377 3300037068 Bacteria 2720
103 Ga0436365_1811146 3300039437 Bacteria 3687
104 Ga0453683_0023616 3300044673 Bacteria 3917
105 Ga0466966_0004182 3300044684 Bacteria 9533
106 Ga0466966_0041787 3300044684 Bacteria 2945
107 Ga0466963_0137118 3300044694 Bacteria 1694
108 Ga0453684_0000012 3300044712 Bacteria 1062512
109 Ga0453684_0044861 3300044712 Bacteria 5907
110 Ga0466957_0014402 3300044842 Unclassified 4605
111 Ga0466957_0114456 3300044842 Bacteria 1714
112 Ga0466959_0001618 3300045049 Bacteria 13891
113 Ga0466959_0065116 3300045049 Bacteria 2645
114 Ga0451576_0000311 3300045051 Bacteria 117825
115 Ga0451576_0001361 3300045051 Bacteria 42065
116 Ga0451576_0041450 3300045051 Bacteria 4867
117 Ga0466958_0008245 3300045836 Bacteria 5769
118 Ga0495629_0114718 3300046459 Bacteria 1877
119 Ga0495651_0063455 3300046462 Bacteria 2824
120 Ga0495653_0031894 3300046463 Bacteria 4187
121 Ga0495580_0001699 3300046472 Bacteria 19345
122 Ga0495582_0001106 3300046473 Bacteria 15135
123 Ga0495582_0010156 3300046473 Bacteria 5185
124 Ga0495639_0014678 3300046475 Bacteria 3393
125 Ga0495662_0010714 3300046476 Bacteria 4483
126 Ga0495594_0093163 3300046499 Bacteria 1689
127 Ga0495630_0100662 3300046517 Bacteria 2186
128 Ga0495666_0073736 3300046526 Bacteria 1619
129 Ga0495640_0014258 3300046533 Bacteria 6021
130 Ga0495587_0113591 3300046536 Bacteria 1554
131 Ga0495623_0049159 3300046679 Bacteria 2673
132 Ga0495647_0002371 3300046681 Bacteria 5928
133 Ga0495658_0008718 3300046683 Bacteria 5036
134 Ga0495624_0087154 3300046690 Bacteria 1928
135 Ga0495581_0016008 3300047315 Bacteria 4358
136 Ga0495604_0002881 3300047317 Bacteria 13784
137 Ga0495674_0033549 3300047319 Bacteria 4648
138 Ga0495676_0248854 3300047321 Bacteria 1213
139 Ga0495680_0023837 3300047322 Bacteria 5085
140 Ga0495602_0089795 3300048088 Bacteria 2554
141 Ga0496105_0055091 3300048908 Bacteria 3284
142 Ga0496114_0001138 3300048917 Bacteria 20094
143 Ga0496115_0028184 3300048918 Bacteria 4400
144 Ga0496115_0041036 3300048918 Bacteria 3680
145 Ga0501038_0116769 3300049574 Bacteria 2205
146 Ga0501074_0182054 3300049590 Bacteria 1499
147 Ga0501080_0256874 3300049742 Bacteria 1593
148 nmdc:mga05p37_47087_c1 3300050507 Bacteria 5303
149 nmdc:mga06r32_212352_c1 3300050510 Bacteria 1923
150 nmdc:mga06r32_64711_c1 3300050510 Bacteria 3526
151 nmdc:mga06r32_981_c2 3300050510 Bacteria 13807
152 nmdc:mga0rr50_39645_c1 3300050513 Bacteria 3418
153 nmdc:mga0rr50_89747_c1 3300050513 Bacteria 2390
154 Ga0495619_0150278 3300053085 Bacteria 1607
155 Ga0500578_0034053 3300053086 Bacteria 3273
156 Ga0500651_0000072 3300053093 Bacteria 65983
157 Ga0500566_0001274 3300053094 Bacteria 14705
158 Ga0500640_001662 3300053095 Bacteria 6904
159 Ga0500554_008085 3300053102 Bacteria 2454
160 Ga0500572_004272 3300053111 Bacteria 3245
161 Ga0500595_000128 3300053119 Bacteria 49404
162 Ga0500614_000222 3300053123 Bacteria 14972
163 Ga0500559_0002196 3300053136 Bacteria 10321
164 Ga0500577_0001245 3300053142 Bacteria 6504
165 Ga0500585_032575 3300053144 Bacteria 1803
166 Ga0500619_023327 3300053154 Bacteria 1807
167 Ga0500639_145790 3300053163 Bacteria 1099
168 Ga0530510_0283598 3300061734 Bacteria 1238

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0131262 Ga0373937_0131262_12_857 278
2 3300046517 Ga0495630_0100662 Ga0495630_0100662_1289_2134 278
3 3300009551 Ga0105238_10015738 Ga0105238_100157383 298
4 3300010375 Ga0105239_10355353 Ga0105239_103553533 298
5 3300013105 Ga0157369_10046202 Ga0157369_100462022 298
6 3300013296 Ga0157374_10087172 Ga0157374_100871722 298
7 3300061734 Ga0530510_0283598 Ga0530510_0283598_42_938 298
8 3300025908 Ga0207643_10117626 Ga0207643_101176262 304
9 3300044842 Ga0466957_0014402 Ga0466957_0014402_3325_4290 311
10 3300005841 Ga0068863_100216827 Ga0068863_1002168272 314
11 3300053163 Ga0500639_145790 Ga0500639_145790_55_1071 314
12 3300053093 Ga0500651_0000072 Ga0500651_0000072_41124_42080 317
13 3300031247 Ga0265340_10017552 Ga0265340_100175524 320
14 3300031344 Ga0265316_10320418 Ga0265316_103204181 320
15 3300053142 Ga0500577_0001245 Ga0500577_0001245_1639_2607 321
16 3300044712 Ga0453684_0044861 Ga0453684_0044861_3193_4191 322
17 3300045051 Ga0451576_0001361 Ga0451576_0001361_12455_13453 322
18 3300044684 Ga0466966_0004182 Ga0466966_0004182_2105_3115 323
19 3300044684 Ga0466966_0041787 Ga0466966_0041787_1549_2559 323
20 3300044694 Ga0466963_0137118 Ga0466963_0137118_254_1261 323
21 3300044842 Ga0466957_0114456 Ga0466957_0114456_626_1633 323
22 3300045049 Ga0466959_0001618 Ga0466959_0001618_118_1128 323
23 3300045836 Ga0466958_0008245 Ga0466958_0008245_2592_3602 323
24 3300005545 Ga0070695_100152437 Ga0070695_1001524372 324
25 3300005547 Ga0070693_100116706 Ga0070693_1001167062 324
26 3300006847 Ga0075431_100002422 Ga0075431_10000242212 324
27 3300031344 Ga0265316_10000008 Ga0265316_1000000852 324
28 3300031728 Ga0316578_10113010 Ga0316578_101130101 324
29 3300031733 Ga0316577_10151633 Ga0316577_101516331 324
30 3300035398 Ga0316574_0015041 Ga0316574_0015041_2592_3572 324
31 3300036647 Ga0316582_0003335 Ga0316582_0003335_5893_6873 324
32 3300044673 Ga0453683_0023616 Ga0453683_0023616_1299_2273 324
33 3300045049 Ga0466959_0065116 Ga0466959_0065116_595_1596 324
34 3300045051 Ga0451576_0000311 Ga0451576_0000311_10174_11148 324
35 3300050510 nmdc:mga06r32_981_c2 nmdc:mga06r32_981_c2_893_1867 324
36 3300005458 Ga0070681_10111964 Ga0070681_101119642 325
37 3300005471 Ga0070698_100010885 Ga0070698_10001088515 325
38 3300005549 Ga0070704_100146336 Ga0070704_1001463362 325
39 3300006237 Ga0097621_100091098 Ga0097621_1000910981 325
40 3300006358 Ga0068871_100238410 Ga0068871_1002384102 325
41 3300006847 Ga0075431_100076829 Ga0075431_1000768293 325
42 3300006880 Ga0075429_100064642 Ga0075429_1000646423 325
43 3300007265 Ga0099794_10018329 Ga0099794_100183294 325
44 3300007265 Ga0099794_10045891 Ga0099794_100458912 325
45 3300007265 Ga0099794_10069207 Ga0099794_100692072 325
46 3300009147 Ga0114129_10015027 Ga0114129_100150274 325
47 3300027671 Ga0209588_1029058 Ga0209588_10290581 325
48 3300031733 Ga0316577_10128500 Ga0316577_101285002 325
49 3300035083 Ga0373926_0072369 Ga0373926_0072369_177_1163 325
50 3300037068 Ga0373925_0066377 Ga0373925_0066377_1677_2663 325
51 3300044712 Ga0453684_0000012 Ga0453684_0000012_977562_978539 325
52 3300046459 Ga0495629_0114718 Ga0495629_0114718_353_1339 325
53 3300046473 Ga0495582_0010156 Ga0495582_0010156_564_1550 325
54 3300046475 Ga0495639_0014678 Ga0495639_0014678_2206_3192 325
55 3300046476 Ga0495662_0010714 Ga0495662_0010714_467_1453 325
56 3300046499 Ga0495594_0093163 Ga0495594_0093163_621_1607 325
57 3300046526 Ga0495666_0073736 Ga0495666_0073736_254_1240 325
58 3300046533 Ga0495640_0014258 Ga0495640_0014258_2111_3097 325
59 3300046681 Ga0495647_0002371 Ga0495647_0002371_1077_2063 325
60 3300046683 Ga0495658_0008718 Ga0495658_0008718_1111_2097 325
61 3300046690 Ga0495624_0087154 Ga0495624_0087154_163_1149 325
62 3300047315 Ga0495581_0016008 Ga0495581_0016008_3085_4071 325
63 3300047319 Ga0495674_0033549 Ga0495674_0033549_618_1604 325
64 3300047321 Ga0495676_0248854 Ga0495676_0248854_185_1171 325
65 3300047322 Ga0495680_0023837 Ga0495680_0023837_2360_3346 325
66 3300048908 Ga0496105_0055091 Ga0496105_0055091_2128_3114 325
67 3300048918 Ga0496115_0041036 Ga0496115_0041036_1523_2560 325
68 3300049574 Ga0501038_0116769 Ga0501038_0116769_581_1558 325
69 3300050507 nmdc:mga05p37_47087_c1 nmdc:mga05p37_47087_c1_195_1172 325
70 3300050510 nmdc:mga06r32_212352_c1 nmdc:mga06r32_212352_c1_880_1857 325
71 3300053085 Ga0495619_0150278 Ga0495619_0150278_169_1155 325
72 3300005295 Ga0065707_10090462 Ga0065707_100904623 326
73 3300005295 Ga0065707_10149779 Ga0065707_101497791 326
74 3300005338 Ga0068868_100075095 Ga0068868_1000750953 326
75 3300005434 Ga0070709_10013861 Ga0070709_100138613 326
76 3300005434 Ga0070709_10054399 Ga0070709_100543992 326
77 3300005436 Ga0070713_100203998 Ga0070713_1002039982 326
78 3300005437 Ga0070710_10048177 Ga0070710_100481772 326
79 3300005445 Ga0070708_100006946 Ga0070708_1000069462 326
80 3300005445 Ga0070708_100077092 Ga0070708_1000770921 326
81 3300005445 Ga0070708_100084550 Ga0070708_1000845502 326
82 3300005467 Ga0070706_100312563 Ga0070706_1003125632 326
83 3300005468 Ga0070707_100218784 Ga0070707_1002187842 326
84 3300005471 Ga0070698_100006061 Ga0070698_1000060612 326
85 3300005471 Ga0070698_100368167 Ga0070698_1003681672 326
86 3300005518 Ga0070699_100123367 Ga0070699_1001233671 326
87 3300005535 Ga0070684_100040980 Ga0070684_1000409803 326
88 3300005536 Ga0070697_100001178 Ga0070697_10000117813 326
89 3300005539 Ga0068853_100034450 Ga0068853_1000344502 326
90 3300005548 Ga0070665_100003135 Ga0070665_10000313511 326
91 3300005616 Ga0068852_100052673 Ga0068852_1000526732 326
92 3300005841 Ga0068863_100028997 Ga0068863_1000289972 326
93 3300005843 Ga0068860_100253406 Ga0068860_1002534061 326
94 3300006163 Ga0070715_10105792 Ga0070715_101057921 326
95 3300006173 Ga0070716_100028848 Ga0070716_1000288482 326
96 3300006173 Ga0070716_100211637 Ga0070716_1002116371 326
97 3300006175 Ga0070712_100133641 Ga0070712_1001336412 326
98 3300006175 Ga0070712_100145616 Ga0070712_1001456162 326
99 3300006175 Ga0070712_100355018 Ga0070712_1003550181 326
100 3300006847 Ga0075431_100100355 Ga0075431_1001003553 326
101 3300006852 Ga0075433_10190460 Ga0075433_101904602 326
102 3300006871 Ga0075434_100007018 Ga0075434_1000070187 326
103 3300006871 Ga0075434_100025711 Ga0075434_1000257112 326
104 3300007076 Ga0075435_100005989 Ga0075435_1000059892 326
105 3300007788 Ga0099795_10034946 Ga0099795_100349462 326
106 3300009147 Ga0114129_10414849 Ga0114129_104148492 326
107 3300009545 Ga0105237_10109797 Ga0105237_101097972 326
108 3300009553 Ga0105249_10460961 Ga0105249_104609611 326
109 3300010375 Ga0105239_10684336 Ga0105239_106843361 326
110 3300013297 Ga0157378_10032645 Ga0157378_100326452 326
111 3300014968 Ga0157379_10114623 Ga0157379_101146233 326
112 3300014968 Ga0157379_10319923 Ga0157379_103199232 326
113 3300014969 Ga0157376_10000005 Ga0157376_10000005135 326
114 3300025906 Ga0207699_10003765 Ga0207699_100037652 326
115 3300025910 Ga0207684_10043451 Ga0207684_100434511 326
116 3300025910 Ga0207684_10210405 Ga0207684_102104052 326
117 3300025915 Ga0207693_10016050 Ga0207693_100160503 326
118 3300025915 Ga0207693_10023611 Ga0207693_100236112 326
119 3300025915 Ga0207693_10080363 Ga0207693_100803632 326
120 3300025915 Ga0207693_10148832 Ga0207693_101488322 326
121 3300025916 Ga0207663_10154440 Ga0207663_101544401 326
122 3300025916 Ga0207663_10156005 Ga0207663_101560052 326
123 3300025922 Ga0207646_10004491 Ga0207646_100044911 326
124 3300025922 Ga0207646_10073780 Ga0207646_100737803 326
125 3300025922 Ga0207646_10297126 Ga0207646_102971261 326
126 3300025928 Ga0207700_10026126 Ga0207700_100261262 326
127 3300025929 Ga0207664_10313363 Ga0207664_103133631 326
128 3300025934 Ga0207686_10193238 Ga0207686_101932381 326
129 3300025939 Ga0207665_10071443 Ga0207665_100714432 326
130 3300025939 Ga0207665_10075406 Ga0207665_100754062 326
131 3300025939 Ga0207665_10084088 Ga0207665_100840882 326
132 3300025944 Ga0207661_10004479 Ga0207661_100044799 326
133 3300026023 Ga0207677_10135983 Ga0207677_101359832 326
134 3300026088 Ga0207641_10001507 Ga0207641_1000150718 326
135 3300028379 Ga0268266_10002354 Ga0268266_1000235418 326
136 3300028381 Ga0268264_10142219 Ga0268264_101422191 326
137 3300028800 Ga0265338_10214830 Ga0265338_102148301 326
138 3300031665 Ga0316575_10018454 Ga0316575_100184542 326
139 3300031691 Ga0316579_10145218 Ga0316579_101452181 326
140 3300036401 Ga0373937_0032891 Ga0373937_0032891_2011_3015 326
141 3300036647 Ga0316582_0063509 Ga0316582_0063509_1249_2256 326
142 3300039437 Ga0436365_1811146 Ga0436365_1811146_2135_3226 326
143 3300045051 Ga0451576_0041450 Ga0451576_0041450_1287_2267 326
144 3300046462 Ga0495651_0063455 Ga0495651_0063455_1180_2184 326
145 3300046463 Ga0495653_0031894 Ga0495653_0031894_988_1992 326
146 3300046472 Ga0495580_0001699 Ga0495580_0001699_2644_3702 326
147 3300046473 Ga0495582_0001106 Ga0495582_0001106_10691_11749 326
148 3300046536 Ga0495587_0113591 Ga0495587_0113591_384_1388 326
149 3300046679 Ga0495623_0049159 Ga0495623_0049159_1637_2641 326
150 3300047317 Ga0495604_0002881 Ga0495604_0002881_7601_8605 326
151 3300048088 Ga0495602_0089795 Ga0495602_0089795_47_1051 326
152 3300048917 Ga0496114_0001138 Ga0496114_0001138_6064_7068 326
153 3300048918 Ga0496115_0028184 Ga0496115_0028184_104_1108 326
154 3300049590 Ga0501074_0182054 Ga0501074_0182054_60_1043 326
155 3300049742 Ga0501080_0256874 Ga0501080_0256874_381_1367 326
156 3300050510 nmdc:mga06r32_64711_c1 nmdc:mga06r32_64711_c1_934_1938 326
157 3300050513 nmdc:mga0rr50_39645_c1 nmdc:mga0rr50_39645_c1_2096_3103 326
158 3300050513 nmdc:mga0rr50_89747_c1 nmdc:mga0rr50_89747_c1_297_1343 326
159 3300053086 Ga0500578_0034053 Ga0500578_0034053_1851_2861 326
160 3300053094 Ga0500566_0001274 Ga0500566_0001274_2690_3700 326
161 3300053095 Ga0500640_001662 Ga0500640_001662_3153_4163 326
162 3300053102 Ga0500554_008085 Ga0500554_008085_461_1471 326
163 3300053111 Ga0500572_004272 Ga0500572_004272_1911_2921 326
164 3300053119 Ga0500595_000128 Ga0500595_000128_19374_20384 326
165 3300053123 Ga0500614_000222 Ga0500614_000222_4232_5242 326
166 3300053136 Ga0500559_0002196 Ga0500559_0002196_2701_3711 326
167 3300053144 Ga0500585_032575 Ga0500585_032575_265_1275 326
168 3300053154 Ga0500619_023327 Ga0500619_023327_290_1300 326

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

22

268

0.95

PF04321

RmlD_sub_bind

RmlD substrate binding domain

20

201

0.91

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

23

173

0.87

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

22

197

0.85

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

23

332

0.85

PF05368

NmrA

NmrA-like family

22

170

0.83

PF13460

NAD_binding_10

NAD(P)H-binding

26

175

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gy8-assembly1.cif.gz_A trypanosoma brucei udp-galactose 4' epimerase 0.9589 1 324
1gy8-assembly2.cif.gz_C trypanosoma brucei udp-galactose 4' epimerase 0.9541 1 324
6k0g-assembly1.cif.gz_A crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with nad+ and udp 0.9537 1 322
2cnb-assembly2.cif.gz_C trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose 0.9512 1 324
1hzj-assembly1.cif.gz_B human udp-galactose 4-epimerase: accommodation of udp-n-acetylglucosamine within the active site 0.9506 2 325
ID Description Score Start End Superfamily
af_Q4DUZ8_207_378_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9616 172 320 3.90.25.10
af_A0A1D6K005_288_418_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9528 196 322 3.90.25.10
af_A0A1D6PCE2_262_419_3.90.25.10 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.949 177 323 3.90.25.10
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 1 248 3.40.50.720
2c20A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 1 248 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3L7YCR7-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase) 0.981 111 326 GO:0003978
GO:0033499
AF-A0A6L9IT19-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9798 65 325 GO:0003978
GO:0033499
AF-E3GN16-F1-model_v4 UDP-glucose 4-epimerase 0.9796 188 319 GO:0016853
GO:0033499
AF-A0A3N5RSY8-F1-model_v4 UDP-glucose 4-epimerase (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9765 1 186 GO:0016853
GO:0033499
AF-A0A3D2UQ00-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase) (UDP-galactose 4-epimerase) 0.9758 61 324 GO:0003978
GO:0033499

Feature Viewer

pLDDT pTM Quality
94.79 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map