F253122

General Info

Members Datasets Scaffolds Average Seq Length
168 133 336 148

Family's Representative Sequence

Representative Sequence 3300041406|Ga0439439_0144295|Ga0439439_0144295_28_525
Length 165
Sequence VVVNNTFNHFKKEEIMTIVKRNGGLHNSFPALFNDFFNREMFDWGESNFSNTGTTLPAVNIKETNEAFEVEMAAPGMNKNDFKIELEGNLLTISSETNKQTEEKEGDRYARKEFSYQSFQRSFTLAKDVLDSDKINAKYEDGVLRLLIPKKEEAKQKPPRLIEVS

Samples

Sample ID Description Type Environment
1 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
6 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
105 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
106 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
107 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
108 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
119 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
122 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
123 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
124 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
125 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
128 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
129 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
130 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
133 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.1
Metatranscriptomes 11.31
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.57
Nodule 0
Rhizoplane 1.19
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 25.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439439_0144295 3300041406 Bacteria 673
2 ARcpr5yngRDRAFT_c005005 3300000043 Bacteria 1234
3 ARSoilOldRDRAFT_c003982 3300000044 Bacteria 1259
4 JGI24746J21847_1036352 3300001977 Bacteria 682
5 JGI24033J26618_1024157 3300002155 Bacteria 793
6 Ga0007429J51699_1018803 3300003579 Bacteria 501
7 Ga0032354_1015962 3300003693 Bacteria 518
8 Ga0065714_10072422 3300005288 Bacteria 3367
9 Ga0070676_10259197 3300005328 Unclassified 1164
10 Ga0070690_100942577 3300005330 Bacteria 677
11 Ga0070670_100352231 3300005331 Bacteria 1294
12 Ga0068869_100365585 3300005334 Bacteria 1179
13 Ga0070689_100134094 3300005340 Unclassified 1988
14 Ga0070687_100118324 3300005343 Unclassified 1511
15 Ga0070669_100009302 3300005353 Bacteria 6995
16 Ga0070671_100172579 3300005355 Bacteria 1829
17 Ga0070673_100000840 3300005364 Bacteria 17231
18 Ga0070688_100046321 3300005365 Unclassified 2692
19 Ga0070701_10209152 3300005438 Unclassified 1157
20 Ga0070705_101157919 3300005440 Unclassified 635
21 Ga0070700_100086732 3300005441 Unclassified 2033
22 Ga0068867_100126900 3300005459 Unclassified 1978
23 Ga0070698_100787476 3300005471 Bacteria 895
24 Ga0070684_100495772 3300005535 Bacteria 1131
25 Ga0070672_100052494 3300005543 Bacteria 3183
26 Ga0070695_100748347 3300005545 Bacteria 779
27 Ga0068857_100116425 3300005577 Bacteria 2404
28 Ga0068854_100125962 3300005578 Unclassified 1951
29 Ga0068854_100471132 3300005578 Bacteria 1053
30 Ga0068852_100807307 3300005616 Bacteria 952
31 Ga0068859_100003974 3300005617 Bacteria 15088
32 Ga0068859_101828257 3300005617 Bacteria 671
33 Ga0068861_100001327 3300005719 Bacteria 15510
34 Ga0068851_10099331 3300005834 Bacteria 1542
35 Ga0068870_10003898 3300005840 Bacteria 6364
36 Ga0068870_11286410 3300005840 Unclassified 532
37 Ga0068863_100332007 3300005841 Bacteria 1478
38 Ga0068858_101312264 3300005842 Bacteria 712
39 Ga0068860_100193769 3300005843 Unclassified 1967
40 Ga0068862_100040359 3300005844 Bacteria 3967
41 Ga0075434_101307307 3300006871 Bacteria 736
42 Ga0068865_100589182 3300006881 Unclassified 938
43 Ga0097620_100003974 3300006931 Bacteria 15088
44 Ga0097620_101828290 3300006931 Bacteria 671
45 Ga0105240_12104714 3300009093 Bacteria 586
46 Ga0111539_10002899 3300009094 Bacteria 22770
47 Ga0111539_11453504 3300009094 Bacteria 795
48 Ga0105241_10650489 3300009174 Bacteria 957
49 Ga0105249_10014638 3300009553 Bacteria 6936
50 Ga0105239_10046123 3300010375 Bacteria 4776
51 Ga0105246_11832729 3300011119 Unclassified 581
52 Ga0157373_10156053 3300013100 Bacteria 1605
53 Ga0157371_10031155 3300013102 Bacteria 3842
54 Ga0157371_10061747 3300013102 Bacteria 2657
55 Ga0163162_10003045 3300013306 Bacteria 16018
56 Ga0163162_10112904 3300013306 Bacteria 2816
57 Ga0163162_10474670 3300013306 Bacteria 1382
58 Ga0157372_10063042 3300013307 Bacteria 4155
59 Ga0157372_10186186 3300013307 Bacteria 2404
60 Ga0157372_10205292 3300013307 Bacteria 2283
61 Ga0157372_10764062 3300013307 Bacteria 1124
62 Ga0157372_10963924 3300013307 Bacteria 988
63 Ga0157372_11786073 3300013307 Unclassified 707
64 Ga0157375_10078619 3300013308 Unclassified 3332
65 Ga0157375_10080587 3300013308 Bacteria 3294
66 Ga0157375_10681448 3300013308 Bacteria 1183
67 Ga0163163_10609698 3300014325 Bacteria 1155
68 Ga0157380_10006865 3300014326 Bacteria 8045
69 Ga0157380_10347377 3300014326 Unclassified 1387
70 Ga0157377_10001503 3300014745 Bacteria 10107
71 Ga0157376_12629838 3300014969 Bacteria 543
72 Ga0163161_11039957 3300017792 Bacteria 701
73 Ga0206356_11038237 3300020070 Bacteria 519
74 Ga0206349_1009339 3300020075 Unclassified 522
75 Ga0206349_1483617 3300020075 Bacteria 518
76 Ga0206349_1789788 3300020075 Bacteria 504
77 Ga0206351_10367979 3300020077 Bacteria 542
78 Ga0206351_10637646 3300020077 Bacteria 545
79 Ga0206351_10766183 3300020077 Bacteria 514
80 Ga0206352_10648147 3300020078 Bacteria 516
81 Ga0206352_10895993 3300020078 Bacteria 504
82 Ga0206354_10232784 3300020081 Bacteria 518
83 Ga0206354_11266637 3300020081 Unclassified 513
84 Ga0206353_10407510 3300020082 Unclassified 517
85 Ga0206353_11449601 3300020082 Bacteria 509
86 Ga0206353_11747320 3300020082 Bacteria 517
87 Ga0154015_1007871 3300020610 Bacteria 519
88 Ga0224712_10658139 3300022467 Bacteria 514
89 Ga0207697_10030646 3300025315 Unclassified 2201
90 Ga0207682_10459925 3300025893 Bacteria 603
91 Ga0207645_10262111 3300025907 Unclassified 1145
92 Ga0207643_10006410 3300025908 Bacteria 6301
93 Ga0207671_10043350 3300025914 Bacteria 3327
94 Ga0207662_10203244 3300025918 Unclassified 1283
95 Ga0207681_10003034 3300025923 Bacteria 10556
96 Ga0207650_10001737 3300025925 Bacteria 15479
97 Ga0207650_10354791 3300025925 Unclassified 1207
98 Ga0207650_11033355 3300025925 Bacteria 699
99 Ga0207659_10055278 3300025926 Unclassified 2838
100 Ga0207659_10676982 3300025926 Bacteria 883
101 Ga0207659_11849980 3300025926 Bacteria 512
102 Ga0207644_10203610 3300025931 Bacteria 1562
103 Ga0207706_10360000 3300025933 Unclassified 1264
104 Ga0207670_10268790 3300025936 Unclassified 1324
105 Ga0207704_10334694 3300025938 Unclassified 1173
106 Ga0207691_10088280 3300025940 Bacteria 2781
107 Ga0207689_10327550 3300025942 Unclassified 1272
108 Ga0207679_10050014 3300025945 Bacteria 3052
109 Ga0207651_10048684 3300025960 Bacteria 2867
110 Ga0207712_10415181 3300025961 Unclassified 1134
111 Ga0207640_10090475 3300025981 Bacteria 2118
112 Ga0207677_10310211 3300026023 Unclassified 1307
113 Ga0207708_10096066 3300026075 Bacteria 2289
114 Ga0207641_10488534 3300026088 Unclassified 1194
115 Ga0207648_10028894 3300026089 Bacteria 4915
116 Ga0207674_10055772 3300026116 Bacteria 4016
117 Ga0207675_100000432 3300026118 Bacteria 40627
118 Ga0207698_11465060 3300026142 Bacteria 698
119 Ga0207698_11616177 3300026142 Unclassified 663
120 Ga0207428_10030613 3300027907 Bacteria 4448
121 Ga0268265_10030730 3300028380 Bacteria 3872
122 Ga0268264_10169391 3300028381 Unclassified 1974
123 Ga0307408_100001700 3300031548 Bacteria 16178
124 Ga0316576_10357641 3300031727 Bacteria 1086
125 Ga0307405_10005870 3300031731 Bacteria 5979
126 Ga0307405_10642681 3300031731 Bacteria 871
127 Ga0307410_10409589 3300031852 Bacteria 1097
128 Ga0307410_11907028 3300031852 Bacteria 529
129 Ga0307407_10166986 3300031903 Bacteria 1446
130 Ga0307407_10354315 3300031903 Bacteria 1040
131 Ga0307412_10076141 3300031911 Bacteria 2304
132 Ga0307416_100153883 3300032002 Bacteria 2114
133 Ga0307414_10001000 3300032004 Bacteria 14444
134 Ga0307411_10067441 3300032005 Bacteria 2408
135 Ga0307415_100446249 3300032126 Bacteria 1117
136 Ga0439466_0134405 3300041411 Unclassified 760
137 Ga0451793_1553383 3300041452 Bacteria 865
138 Ga0451807_2009515 3300041486 Unclassified 533
139 Ga0451849_0568881 3300041505 Bacteria 756
140 Ga0439431_0028355 3300041997 Bacteria 1379
141 Ga0439445_0066109 3300042004 Unclassified 995
142 Ga0439445_0090737 3300042004 Bacteria 860
143 Ga0451577_0000949 3300042876 Bacteria 42547
144 Ga0466972_0100670 3300044658 Bacteria 1368
145 Ga0453683_1002923 3300044673 Unclassified 554
146 Ga0453684_0001293 3300044712 Bacteria 74352
147 Ga0451576_2550491 3300045051 Unclassified 522
148 Ga0495632_0207816 3300046519 Bacteria 889
149 Ga0495672_0270758 3300047320 Bacteria 816
150 Ga0495686_0000277 3300047472 Bacteria 90929
151 Ga0495686_0003120 3300047472 Bacteria 14643
152 Ga0501290_019840 3300049513 Bacteria 914
153 Ga0501324_038518 3300049540 Bacteria 541
154 Ga0501047_1206658 3300049581 Bacteria 570
155 Ga0501202_004791 3300049652 Bacteria 2378
156 Ga0501217_156973 3300049661 Bacteria 684
157 Ga0501235_033733 3300049669 Bacteria 1160
158 Ga0501248_004470 3300049678 Unclassified 1058
159 Ga0501269_027061 3300049766 Bacteria 727
160 nmdc:mga08y16_591932_c1 3300050511 Unclassified 1119
161 nmdc:mga08y16_777127_c1 3300050511 Bacteria 952
162 Ga0500646_0014010 3300053090 Unclassified 2079
163 Ga0500569_000229 3300053109 Bacteria 8928
164 Ga0500628_098336 3300053129 Unclassified 771
165 Ga0500658_0026591 3300053134 Unclassified 2231
166 Ga0500568_0012423 3300053139 Bacteria 3919
167 Ga0500577_0016824 3300053142 Bacteria 2315
168 2929244233 2929239360 Bacteria 7745570
169 Ga0439439_0144295
170 ARcpr5yngRDRAFT_c005005
171 ARSoilOldRDRAFT_c003982
172 JGI24746J21847_1036352
173 JGI24033J26618_1024157
174 Ga0007429J51699_1018803
175 Ga0032354_1015962
176 Ga0065714_10072422
177 Ga0070676_10259197
178 Ga0070690_100942577
179 Ga0070670_100352231
180 Ga0068869_100365585
181 Ga0070689_100134094
182 Ga0070687_100118324
183 Ga0070669_100009302
184 Ga0070671_100172579
185 Ga0070673_100000840
186 Ga0070688_100046321
187 Ga0070701_10209152
188 Ga0070705_101157919
189 Ga0070700_100086732
190 Ga0068867_100126900
191 Ga0070698_100787476
192 Ga0070684_100495772
193 Ga0070672_100052494
194 Ga0070695_100748347
195 Ga0068857_100116425
196 Ga0068854_100125962
197 Ga0068854_100471132
198 Ga0068852_100807307
199 Ga0068859_100003974
200 Ga0068859_101828257
201 Ga0068861_100001327
202 Ga0068851_10099331
203 Ga0068870_10003898
204 Ga0068870_11286410
205 Ga0068863_100332007
206 Ga0068858_101312264
207 Ga0068860_100193769
208 Ga0068862_100040359
209 Ga0075434_101307307
210 Ga0068865_100589182
211 Ga0097620_100003974
212 Ga0097620_101828290
213 Ga0105240_12104714
214 Ga0111539_10002899
215 Ga0111539_11453504
216 Ga0105241_10650489
217 Ga0105249_10014638
218 Ga0105239_10046123
219 Ga0105246_11832729
220 Ga0157373_10156053
221 Ga0157371_10031155
222 Ga0157371_10061747
223 Ga0163162_10003045
224 Ga0163162_10112904
225 Ga0163162_10474670
226 Ga0157372_10063042
227 Ga0157372_10186186
228 Ga0157372_10205292
229 Ga0157372_10764062
230 Ga0157372_10963924
231 Ga0157372_11786073
232 Ga0157375_10078619
233 Ga0157375_10080587
234 Ga0157375_10681448
235 Ga0163163_10609698
236 Ga0157380_10006865
237 Ga0157380_10347377
238 Ga0157377_10001503
239 Ga0157376_12629838
240 Ga0163161_11039957
241 Ga0206356_11038237
242 Ga0206349_1009339
243 Ga0206349_1483617
244 Ga0206349_1789788
245 Ga0206351_10367979
246 Ga0206351_10637646
247 Ga0206351_10766183
248 Ga0206352_10648147
249 Ga0206352_10895993
250 Ga0206354_10232784
251 Ga0206354_11266637
252 Ga0206353_10407510
253 Ga0206353_11449601
254 Ga0206353_11747320
255 Ga0154015_1007871
256 Ga0224712_10658139
257 Ga0207697_10030646
258 Ga0207682_10459925
259 Ga0207645_10262111
260 Ga0207643_10006410
261 Ga0207671_10043350
262 Ga0207662_10203244
263 Ga0207681_10003034
264 Ga0207650_10001737
265 Ga0207650_10354791
266 Ga0207650_11033355
267 Ga0207659_10055278
268 Ga0207659_10676982
269 Ga0207659_11849980
270 Ga0207644_10203610
271 Ga0207706_10360000
272 Ga0207670_10268790
273 Ga0207704_10334694
274 Ga0207691_10088280
275 Ga0207689_10327550
276 Ga0207679_10050014
277 Ga0207651_10048684
278 Ga0207712_10415181
279 Ga0207640_10090475
280 Ga0207677_10310211
281 Ga0207708_10096066
282 Ga0207641_10488534
283 Ga0207648_10028894
284 Ga0207674_10055772
285 Ga0207675_100000432
286 Ga0207698_11465060
287 Ga0207698_11616177
288 Ga0207428_10030613
289 Ga0268265_10030730
290 Ga0268264_10169391
291 Ga0307408_100001700
292 Ga0316576_10357641
293 Ga0307405_10005870
294 Ga0307405_10642681
295 Ga0307410_10409589
296 Ga0307410_11907028
297 Ga0307407_10166986
298 Ga0307407_10354315
299 Ga0307412_10076141
300 Ga0307416_100153883
301 Ga0307414_10001000
302 Ga0307411_10067441
303 Ga0307415_100446249
304 Ga0439466_0134405
305 Ga0451793_1553383
306 Ga0451807_2009515
307 Ga0451849_0568881
308 Ga0439431_0028355
309 Ga0439445_0066109
310 Ga0439445_0090737
311 Ga0451577_0000949
312 Ga0466972_0100670
313 Ga0453683_1002923
314 Ga0453684_0001293
315 Ga0451576_2550491
316 Ga0495632_0207816
317 Ga0495672_0270758
318 Ga0495686_0000277
319 Ga0495686_0003120
320 Ga0501290_019840
321 Ga0501324_038518
322 Ga0501047_1206658
323 Ga0501202_004791
324 Ga0501217_156973
325 Ga0501235_033733
326 Ga0501248_004470
327 Ga0501269_027061
328 nmdc:mga08y16_591932_c1
329 nmdc:mga08y16_777127_c1
330 Ga0500646_0014010
331 Ga0500569_000229
332 Ga0500628_098336
333 Ga0500658_0026591
334 Ga0500568_0012423
335 Ga0500577_0016824
336 2929244233

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

60

165

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n3e-assembly1.cif.gz_B zebrafish alphaa crystallin 0.8533 45 139
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8374 47 139
4m5t-assembly3.cif.gz_A disulfide trapped human alphab crystallin core domain in complex with c-terminal peptide 0.8187 47 139
5ltw-assembly1.cif.gz_C complex of human 14-3-3 sigma clu1 mutant with phosphorylated heat shock protein b6 0.816 54 134
2y22-assembly1.cif.gz_A human alphab-crystallin domain (residues 67-157) 0.8132 47 139
ID Description Score Start End Superfamily
af_Q9BQS6_54_129_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.884 56 133 2.60.40.790
af_K7KDM2_43_157_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.846 38 138 2.60.40.790
af_F1R2H6_22_118_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8445 45 136 2.60.40.790
af_Q9BQS6_54_129_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8413 56 133 2.60.40.790
af_Q99PR8_58_152_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8309 45 137 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A136KGP5-F1-model_v4 Acid shock protein 0.8082 45 152
AF-A0A4Z0H4Y0-F1-model_v4 Hsp20/alpha crystallin family protein 0.8058 44 152
AF-A0A845DS11-F1-model_v4 Hsp20 family protein 0.8055 40 152
AF-A0A2N6DXD4-F1-model_v4 SHSP domain-containing protein 0.8048 42 138
AF-A0A1W9HPA8-F1-model_v4 SHSP domain-containing protein 0.7986 40 139

Map