F252975

General Info

Members Datasets Scaffolds Average Seq Length
168 121 336 129

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100270305|Ga0307416_1002703053
Length 156
Sequence MSNENVRRSVARVMIATGFQPPAGPAMTAETTTKAAYPYDTHLDIRYGSGEVIDVPALVAACTHPWYNQTLCRVNESVVRLGVVQGEYHWHKHDDEDEFFHVVSGRFLIDLEDRTVDLAPGQGFVVPRGVMHRPRAPERTVILMVEGAGIVPTGDA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
80 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
81 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
82 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
102 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
103 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
108 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
109 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
110 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
121 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.93
Rhizosphere 88.69
Stem 0
Stem Tuber 0
Unclassified 20.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100270305 3300032002 Bacteria 1668
2 CNXas_1000033 3300000545 Bacteria 29027
3 rootL2_10236643 3300003322 Bacteria 1135
4 Ga0058862_11048185 3300004803 Bacteria 739
5 Ga0065703_1019518 3300005272 Unclassified 2808
6 Ga0070670_101309881 3300005331 Unclassified 663
7 Ga0070687_100861829 3300005343 Unclassified 646
8 Ga0070713_100686507 3300005436 Bacteria 977
9 Ga0070713_102234259 3300005436 Unclassified 530
10 Ga0070711_100214088 3300005439 Bacteria 1494
11 Ga0070708_100085945 3300005445 Bacteria 2856
12 Ga0070708_100556827 3300005445 Bacteria 1081
13 Ga0070708_101429151 3300005445 Bacteria 645
14 Ga0070678_100273174 3300005456 Bacteria 1426
15 Ga0070681_10041972 3300005458 Unclassified 4585
16 Ga0070681_10244216 3300005458 Bacteria 1709
17 Ga0070681_11146858 3300005458 Bacteria 699
18 Ga0070706_100719883 3300005467 Unclassified 925
19 Ga0070707_100325389 3300005468 Bacteria 1494
20 Ga0070707_100382708 3300005468 Bacteria 1367
21 Ga0070698_100155793 3300005471 Bacteria 2230
22 Ga0070699_100115836 3300005518 Bacteria 2355
23 Ga0070699_100242577 3300005518 Unclassified 1609
24 Ga0070699_100409098 3300005518 Bacteria 1227
25 Ga0070679_100073334 3300005530 Bacteria 3415
26 Ga0070672_101137024 3300005543 Unclassified 695
27 Ga0070693_100001777 3300005547 Bacteria 9829
28 Ga0070693_100805836 3300005547 Unclassified 696
29 Ga0070704_100039198 3300005549 Bacteria 3251
30 Ga0068857_100203720 3300005577 Unclassified 1804
31 Ga0068856_100308789 3300005614 Bacteria 1599
32 Ga0068864_100118118 3300005618 Bacteria 2368
33 Ga0068864_100304060 3300005618 Bacteria 1494
34 Ga0068863_100883208 3300005841 Bacteria 894
35 Ga0075428_100006325 3300006844 Bacteria 13172
36 Ga0075428_100028784 3300006844 Bacteria 6148
37 Ga0075428_101244359 3300006844 Bacteria 784
38 Ga0075430_100001023 3300006846 Bacteria 22134
39 Ga0075430_100080617 3300006846 Bacteria 2726
40 Ga0075430_100216308 3300006846 Bacteria 1590
41 Ga0075430_100649589 3300006846 Unclassified 870
42 Ga0075431_100000690 3300006847 Bacteria 29038
43 Ga0075431_100001463 3300006847 Bacteria 21778
44 Ga0075431_100344634 3300006847 Bacteria 1499
45 Ga0075433_10042563 3300006852 Bacteria 3941
46 Ga0075433_10226117 3300006852 Bacteria 1662
47 Ga0075434_100471259 3300006871 Bacteria 1277
48 Ga0075429_100001468 3300006880 Bacteria 19384
49 Ga0075429_100458660 3300006880 Bacteria 1117
50 Ga0075429_101336475 3300006880 Unclassified 625
51 Ga0068865_100604209 3300006881 Bacteria 927
52 Ga0099794_10079258 3300007265 Bacteria 1618
53 Ga0111539_10025948 3300009094 Bacteria 7173
54 Ga0114129_10001484 3300009147 Bacteria 31760
55 Ga0114129_10576445 3300009147 Unclassified 1461
56 Ga0114129_10947889 3300009147 Bacteria 1087
57 Ga0105242_10015848 3300009176 Bacteria 5856
58 Ga0105238_10966643 3300009551 Bacteria 872
59 Ga0105249_10424224 3300009553 Bacteria 1364
60 Ga0105239_10169432 3300010375 Bacteria 2442
61 Ga0157374_12865794 3300013296 Bacteria 510
62 Ga0157378_10052550 3300013297 Bacteria 3625
63 Ga0163163_10235602 3300014325 Bacteria 1880
64 Ga0157376_10012018 3300014969 Bacteria 6408
65 Ga0163161_11104405 3300017792 Bacteria 682
66 Ga0207692_10876867 3300025898 Bacteria 589
67 Ga0207685_10219450 3300025905 Bacteria 903
68 Ga0207684_10890856 3300025910 Unclassified 748
69 Ga0207707_10025867 3300025912 Bacteria 5133
70 Ga0207707_10230693 3300025912 Bacteria 1611
71 Ga0207707_11179094 3300025912 Bacteria 621
72 Ga0207663_10071958 3300025916 Bacteria 2233
73 Ga0207660_10069793 3300025917 Bacteria 2553
74 Ga0207652_10052010 3300025921 Bacteria 3514
75 Ga0207646_10240103 3300025922 Bacteria 1637
76 Ga0207646_10774679 3300025922 Bacteria 855
77 Ga0207646_10869504 3300025922 Unclassified 801
78 Ga0207681_10168057 3300025923 Bacteria 1660
79 Ga0207700_10455080 3300025928 Bacteria 1128
80 Ga0207700_10599319 3300025928 Bacteria 980
81 Ga0207691_11190080 3300025940 Unclassified 632
82 Ga0207702_10292365 3300026078 Bacteria 1544
83 Ga0207641_10844630 3300026088 Bacteria 907
84 Ga0207676_10091917 3300026095 Bacteria 2494
85 Ga0207674_10742236 3300026116 Unclassified 947
86 Ga0209974_10427004 3300027876 Bacteria 523
87 Ga0207428_10146319 3300027907 Bacteria 1801
88 Ga0268264_12319187 3300028381 Bacteria 543
89 Ga0265319_1018127 3300028563 Bacteria 2661
90 Ga0316176_1216076 3300030732 Bacteria 552
91 Ga0265320_10073216 3300031240 Bacteria 1610
92 Ga0307408_100213039 3300031548 Unclassified 1571
93 Ga0307413_10952051 3300031824 Unclassified 733
94 Ga0307413_11661725 3300031824 Bacteria 569
95 Ga0307409_100619847 3300031995 Bacteria 1072
96 Ga0307411_12035889 3300032005 Unclassified 536
97 Ga0307415_100308720 3300032126 Unclassified 1314
98 Ga0373932_0035939 3300035112 Bacteria 1404
99 Ga0373957_0407433 3300035120 Bacteria 585
100 Ga0373955_0316333 3300035172 Bacteria 943
101 Ga0373933_0047967 3300035724 Bacteria 2542
102 Ga0373937_0002495 3300036401 Bacteria 15289
103 Ga0395898_0525479 3300037466 Bacteria 1125
104 Ga0395905_0020524 3300037471 Bacteria 6258
105 Ga0395905_0054134 3300037471 Bacteria 3755
106 Ga0395905_0074971 3300037471 Bacteria 3171
107 Ga0395905_1547685 3300037471 Bacteria 568
108 Ga0436364_0469831 3300037853 Unclassified 1194
109 Ga0395901_1124238 3300038443 Bacteria 755
110 Ga0242419_004689 3300038698 Bacteria 959
111 Ga0242420_007430 3300038996 Bacteria 1757
112 Ga0242420_017637 3300038996 Bacteria 1251
113 Ga0451855_1694141 3300041511 Unclassified 516
114 Ga0450914_001521 3300042118 Bacteria 1476
115 Ga0439434_0223824 3300042435 Bacteria 639
116 Ga0439464_0046910 3300042439 Unclassified 1242
117 Ga0451577_1417322 3300042876 Bacteria 616
118 Ga0466980_0130155 3300044668 Bacteria 1696
119 Ga0466966_0008983 3300044684 Bacteria 6623
120 Ga0466961_0205655 3300044693 Bacteria 1216
121 Ga0466970_0005293 3300044765 Bacteria 6394
122 Ga0466959_0017606 3300045049 Bacteria 5239
123 Ga0451576_0015195 3300045051 Bacteria 8541
124 Ga0451576_0404583 3300045051 Bacteria 1431
125 Ga0451576_1099162 3300045051 Bacteria 832
126 Ga0451576_1243376 3300045051 Unclassified 777
127 Ga0495580_0056942 3300046472 Bacteria 2752
128 Ga0495582_0416855 3300046473 Unclassified 775
129 Ga0495594_0092822 3300046499 Bacteria 1693
130 Ga0495588_0609354 3300046674 Unclassified 572
131 Ga0495657_0390599 3300046675 Bacteria 820
132 Ga0495646_0419998 3300046680 Bacteria 693
133 Ga0496101_0244421 3300048904 Bacteria 1397
134 Ga0496102_0146174 3300048905 Unclassified 2219
135 Ga0496104_0080797 3300048907 Unclassified 3100
136 Ga0496106_0144989 3300048909 Bacteria 1870
137 Ga0496108_0001687 3300048911 Bacteria 17514
138 Ga0496108_1053154 3300048911 Bacteria 693
139 Ga0496109_0007833 3300048912 Bacteria 9048
140 Ga0496109_1078694 3300048912 Unclassified 740
141 Ga0496109_1272867 3300048912 Bacteria 672
142 Ga0496110_0044915 3300048913 Bacteria 3859
143 Ga0496111_0110756 3300048914 Bacteria 2022
144 Ga0496112_0018276 3300048915 Bacteria 6599
145 Ga0496112_0675876 3300048915 Bacteria 961
146 Ga0496113_0001581 3300048916 Bacteria 12787
147 Ga0496114_0729656 3300048917 Bacteria 867
148 Ga0501209_212741 3300049656 Bacteria 597
149 Ga0501233_074986 3300049668 Unclassified 863
150 nmdc:mga05p37_620_c1 3300050507 Bacteria 39253
151 nmdc:mga09592_1170608_c1 3300050508 Unclassified 637
152 nmdc:mga09592_26484_c1 3300050508 Bacteria 4804
153 nmdc:mga09592_307438_c1 3300050508 Bacteria 1374
154 nmdc:mga09592_949_c1 3300050508 Bacteria 22803
155 nmdc:mga0qj67_105641_c1 3300050509 Bacteria 2272
156 nmdc:mga0qj67_152461_c1 3300050509 Unclassified 1875
157 nmdc:mga0qj67_506_c1 3300050509 Bacteria 26635
158 nmdc:mga0qj67_887_c1 3300050509 Bacteria 20521
159 nmdc:mga06r32_644_c1 3300050510 Bacteria 30414
160 nmdc:mga06r32_766749_c1 3300050510 Unclassified 927
161 nmdc:mga06r32_934_c1 3300050510 Bacteria 25991
162 nmdc:mga08y16_100285_c1 3300050511 Bacteria 3015
163 nmdc:mga0n895_1843391_c1 3300050512 Unclassified 565
164 nmdc:mga08x19_394216_c1 3300050514 Bacteria 970
165 Ga0495601_0532956 3300053077 Bacteria 756
166 Ga0495619_0292903 3300053085 Bacteria 1128
167 Ga0590071_008361 3300059421 Bacteria 2439
168 Ga0590077_005378 3300059426 Bacteria 2623
169 Ga0307416_100270305
170 CNXas_1000033
171 rootL2_10236643
172 Ga0058862_11048185
173 Ga0065703_1019518
174 Ga0070670_101309881
175 Ga0070687_100861829
176 Ga0070713_100686507
177 Ga0070713_102234259
178 Ga0070711_100214088
179 Ga0070708_100085945
180 Ga0070708_100556827
181 Ga0070708_101429151
182 Ga0070678_100273174
183 Ga0070681_10041972
184 Ga0070681_10244216
185 Ga0070681_11146858
186 Ga0070706_100719883
187 Ga0070707_100325389
188 Ga0070707_100382708
189 Ga0070698_100155793
190 Ga0070699_100115836
191 Ga0070699_100242577
192 Ga0070699_100409098
193 Ga0070679_100073334
194 Ga0070672_101137024
195 Ga0070693_100001777
196 Ga0070693_100805836
197 Ga0070704_100039198
198 Ga0068857_100203720
199 Ga0068856_100308789
200 Ga0068864_100118118
201 Ga0068864_100304060
202 Ga0068863_100883208
203 Ga0075428_100006325
204 Ga0075428_100028784
205 Ga0075428_101244359
206 Ga0075430_100001023
207 Ga0075430_100080617
208 Ga0075430_100216308
209 Ga0075430_100649589
210 Ga0075431_100000690
211 Ga0075431_100001463
212 Ga0075431_100344634
213 Ga0075433_10042563
214 Ga0075433_10226117
215 Ga0075434_100471259
216 Ga0075429_100001468
217 Ga0075429_100458660
218 Ga0075429_101336475
219 Ga0068865_100604209
220 Ga0099794_10079258
221 Ga0111539_10025948
222 Ga0114129_10001484
223 Ga0114129_10576445
224 Ga0114129_10947889
225 Ga0105242_10015848
226 Ga0105238_10966643
227 Ga0105249_10424224
228 Ga0105239_10169432
229 Ga0157374_12865794
230 Ga0157378_10052550
231 Ga0163163_10235602
232 Ga0157376_10012018
233 Ga0163161_11104405
234 Ga0207692_10876867
235 Ga0207685_10219450
236 Ga0207684_10890856
237 Ga0207707_10025867
238 Ga0207707_10230693
239 Ga0207707_11179094
240 Ga0207663_10071958
241 Ga0207660_10069793
242 Ga0207652_10052010
243 Ga0207646_10240103
244 Ga0207646_10774679
245 Ga0207646_10869504
246 Ga0207681_10168057
247 Ga0207700_10455080
248 Ga0207700_10599319
249 Ga0207691_11190080
250 Ga0207702_10292365
251 Ga0207641_10844630
252 Ga0207676_10091917
253 Ga0207674_10742236
254 Ga0209974_10427004
255 Ga0207428_10146319
256 Ga0268264_12319187
257 Ga0265319_1018127
258 Ga0316176_1216076
259 Ga0265320_10073216
260 Ga0307408_100213039
261 Ga0307413_10952051
262 Ga0307413_11661725
263 Ga0307409_100619847
264 Ga0307411_12035889
265 Ga0307415_100308720
266 Ga0373932_0035939
267 Ga0373957_0407433
268 Ga0373955_0316333
269 Ga0373933_0047967
270 Ga0373937_0002495
271 Ga0395898_0525479
272 Ga0395905_0020524
273 Ga0395905_0054134
274 Ga0395905_0074971
275 Ga0395905_1547685
276 Ga0436364_0469831
277 Ga0395901_1124238
278 Ga0242419_004689
279 Ga0242420_007430
280 Ga0242420_017637
281 Ga0451855_1694141
282 Ga0450914_001521
283 Ga0439434_0223824
284 Ga0439464_0046910
285 Ga0451577_1417322
286 Ga0466980_0130155
287 Ga0466966_0008983
288 Ga0466961_0205655
289 Ga0466970_0005293
290 Ga0466959_0017606
291 Ga0451576_0015195
292 Ga0451576_0404583
293 Ga0451576_1099162
294 Ga0451576_1243376
295 Ga0495580_0056942
296 Ga0495582_0416855
297 Ga0495594_0092822
298 Ga0495588_0609354
299 Ga0495657_0390599
300 Ga0495646_0419998
301 Ga0496101_0244421
302 Ga0496102_0146174
303 Ga0496104_0080797
304 Ga0496106_0144989
305 Ga0496108_0001687
306 Ga0496108_1053154
307 Ga0496109_0007833
308 Ga0496109_1078694
309 Ga0496109_1272867
310 Ga0496110_0044915
311 Ga0496111_0110756
312 Ga0496112_0018276
313 Ga0496112_0675876
314 Ga0496113_0001581
315 Ga0496114_0729656
316 Ga0501209_212741
317 Ga0501233_074986
318 nmdc:mga05p37_620_c1
319 nmdc:mga09592_1170608_c1
320 nmdc:mga09592_26484_c1
321 nmdc:mga09592_307438_c1
322 nmdc:mga09592_949_c1
323 nmdc:mga0qj67_105641_c1
324 nmdc:mga0qj67_152461_c1
325 nmdc:mga0qj67_506_c1
326 nmdc:mga0qj67_887_c1
327 nmdc:mga06r32_644_c1
328 nmdc:mga06r32_766749_c1
329 nmdc:mga06r32_934_c1
330 nmdc:mga08y16_100285_c1
331 nmdc:mga0n895_1843391_c1
332 nmdc:mga08x19_394216_c1
333 Ga0495601_0532956
334 Ga0495619_0292903
335 Ga0590071_008361
336 Ga0590077_005378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

78

146

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.9649 29 124
3dl3-assembly3.cif.gz_B crystal structure of the tellurite resistance protein tehb. northeast structural genomics consortium target vfr98 . 0.9116 66 123
3kmh-assembly1.cif.gz_B crystal structure of a novel sugar isomerase from e. coli o157:h7 0.9085 54 124
3kmh-assembly1.cif.gz_A crystal structure of a novel sugar isomerase from e. coli o157:h7 0.9075 54 124
3pu3-assembly2.cif.gz_B phf2 jumonji domain-nog complex 0.9065 56 124
ID Description Score Start End Superfamily
3d82C00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9169 28 124 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9119 54 123 2.60.120.10
af_Q2G1P7_1_117_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9072 69 124 2.60.120.10
2y0oA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8982 55 124 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8938 45 124 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A845KYA1-F1-model_v4 Cupin domain-containing protein 0.9955 29 129
AF-A0A2B3L6T5-F1-model_v4 deleted 0.9853 50 124
AF-G4NU07-F1-model_v4 YdbB 0.9791 28 126 GO:0030145
AF-A0A256Z3T5-F1-model_v4 Cupin 0.9768 26 132
AF-A0A117SJV9-F1-model_v4 Cupin 0.9764 16 132

Map