F252576

General Info

Members Datasets Scaffolds Average Seq Length
168 125 167 72

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10543289|Ga0114129_105432893
Length 81
Sequence VKNMQEHTMNSQTMTSDVTASYELRFQSLFNEGRALAFPCDARGSVELDALSEQARNNYLYARAVIGVEFAVPAVRRRDLH

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
71 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
72 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
73 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
74 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
75 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
76 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
77 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
78 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
81 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
82 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
83 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
84 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
85 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
86 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
87 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
90 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
93 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
104 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
110 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
111 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
112 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
113 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
114 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
122 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
123 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
124 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
125 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.6
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.88
Nodule 0
Rhizoplane 4.76
Rhizosphere 66.07
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1003478 3300003347 Bacteria 1042
2 Ga0065707_10224498 3300005295 Bacteria 1212
3 Ga0070676_10709198 3300005328 Bacteria 735
4 Ga0068868_100110536 3300005338 Bacteria 2233
5 Ga0070674_100982246 3300005356 Bacteria 740
6 Ga0070673_102132557 3300005364 Bacteria 532
7 Ga0070667_100140979 3300005367 Bacteria 2111
8 Ga0070667_100823779 3300005367 Bacteria 862
9 Ga0070667_101935964 3300005367 Unclassified 555
10 Ga0070708_100355627 3300005445 Bacteria 1380
11 Ga0070663_100013312 3300005455 Bacteria 5240
12 Ga0070678_100203049 3300005456 Bacteria 1637
13 Ga0068867_100000005 3300005459 Bacteria 174097
14 Ga0068867_100223015 3300005459 Bacteria 1520
15 Ga0068867_100940806 3300005459 Bacteria 780
16 Ga0070706_100078703 3300005467 Bacteria 3052
17 Ga0068853_100079770 3300005539 Bacteria 2863
18 Ga0070672_100936208 3300005543 Bacteria 766
19 Ga0070665_101021919 3300005548 Bacteria 839
20 Ga0068852_100025758 3300005616 Bacteria 4771
21 Ga0068852_100357313 3300005616 Bacteria 1428
22 Ga0068863_102239564 3300005841 Unclassified 556
23 Ga0068860_100141342 3300005843 Bacteria 2314
24 Ga0068860_100229446 3300005843 Bacteria 1804
25 Ga0068860_100634928 3300005843 Bacteria 1075
26 Ga0068862_100848180 3300005844 Bacteria 895
27 Ga0075365_10021951 3300006038 Bacteria 3992
28 Ga0075364_10245889 3300006051 Bacteria 1215
29 Ga0075369_10296177 3300006186 Bacteria 755
30 Ga0075366_10002486 3300006195 Bacteria 9454
31 Ga0075366_10008372 3300006195 Bacteria 5746
32 Ga0075366_10037243 3300006195 Bacteria 2871
33 Ga0075366_10039499 3300006195 Bacteria 2790
34 Ga0075366_10334542 3300006195 Bacteria 928
35 Ga0075370_10231142 3300006353 Bacteria 1094
36 Ga0075430_100025210 3300006846 Bacteria 5058
37 Ga0075430_101126468 3300006846 Unclassified 646
38 Ga0075429_100000203 3300006880 Bacteria 39542
39 Ga0075429_101448895 3300006880 Unclassified 598
40 Ga0105240_10078074 3300009093 Bacteria 4078
41 Ga0105240_11964958 3300009093 Unclassified 608
42 Ga0114129_10333536 3300009147 Bacteria 2013
43 Ga0114129_10543289 3300009147 Bacteria 1512
44 Ga0114129_12182105 3300009147 Bacteria 667
45 Ga0114129_12387500 3300009147 Bacteria 633
46 Ga0105237_10002045 3300009545 Bacteria 25656
47 Ga0105238_10001158 3300009551 Bacteria 26593
48 Ga0105249_12432594 3300009553 Bacteria 596
49 Ga0105239_10004965 3300010375 Bacteria 15709
50 Ga0157373_11407378 3300013100 Bacteria 530
51 Ga0157378_10360486 3300013297 Bacteria 1423
52 Ga0157377_10000022 3300014745 Bacteria 146702
53 Ga0157379_10963987 3300014968 Bacteria 812
54 Ga0157376_11094518 3300014969 Bacteria 822
55 Ga0207680_10350245 3300025903 Bacteria 1037
56 Ga0207684_10437376 3300025910 Bacteria 1123
57 Ga0207695_10004136 3300025913 Bacteria 19925
58 Ga0207671_10004715 3300025914 Bacteria 12884
59 Ga0207694_10161435 3300025924 Bacteria 1810
60 Ga0207644_10505161 3300025931 Bacteria 998
61 Ga0207709_10003616 3300025935 Bacteria 9133
62 Ga0207651_11950528 3300025960 Bacteria 528
63 Ga0207712_11137798 3300025961 Bacteria 695
64 Ga0207658_10545213 3300025986 Unclassified 1037
65 Ga0207658_10930765 3300025986 Bacteria 792
66 Ga0207677_10793200 3300026023 Bacteria 847
67 Ga0207677_11797110 3300026023 Bacteria 569
68 Ga0207639_10044424 3300026041 Bacteria 3341
69 Ga0207678_10130026 3300026067 Bacteria 2148
70 Ga0207641_12317871 3300026088 Unclassified 536
71 Ga0207648_10000032 3300026089 Bacteria 128009
72 Ga0207648_10674916 3300026089 Bacteria 956
73 Ga0207648_11181505 3300026089 Bacteria 718
74 Ga0207683_10192575 3300026121 Bacteria 1851
75 Ga0207683_10323688 3300026121 Bacteria 1412
76 Ga0207698_10020858 3300026142 Bacteria 4520
77 Ga0207698_10307391 3300026142 Bacteria 1479
78 Ga0209981_1056481 3300027378 Bacteria 598
79 Ga0209996_1005952 3300027395 Bacteria 1568
80 Ga0209995_1023182 3300027471 Bacteria 1032
81 Ga0209968_1001694 3300027526 Bacteria 3331
82 Ga0209966_1000090 3300027695 Bacteria 39638
83 Ga0209998_10029035 3300027717 Bacteria 1218
84 Ga0268264_10343365 3300028381 Bacteria 1419
85 Ga0268264_11049407 3300028381 Bacteria 822
86 Ga0268264_12565889 3300028381 Unclassified 514
87 Ga0307515_10009057 3300028794 Bacteria 19316
88 Ga0307513_10028714 3300031456 Bacteria 6354
89 Ga0307509_10252461 3300031507 Bacteria 1546
90 Ga0307509_10713744 3300031507 Unclassified 669
91 Ga0307514_10282696 3300031649 Bacteria 948
92 Ga0307516_10019389 3300031730 Bacteria 7045
93 Ga0307516_10294892 3300031730 Bacteria 1299
94 Ga0307412_10792297 3300031911 Bacteria 822
95 Ga0439439_0054539 3300041406 Bacteria 1053
96 Ga0439461_0073328 3300041410 Unclassified 797
97 Ga0451789_0626469 3300041443 Bacteria 1287
98 Ga0451791_0379872 3300041451 Bacteria 1711
99 Ga0451793_1622299 3300041452 Bacteria 786
100 Ga0451793_1727319 3300041452 Bacteria 1246
101 Ga0451795_1349654 3300041456 Bacteria 1196
102 Ga0451800_0303826 3300041459 Bacteria 2118
103 Ga0451802_0537001 3300041460 Bacteria 1996
104 Ga0451802_1146150 3300041460 Unclassified 582
105 Ga0451835_0817551 3300041492 Bacteria 1133
106 Ga0451839_0313634 3300041496 Unclassified 512
107 Ga0451839_0505753 3300041496 Bacteria 982
108 Ga0451841_0426578 3300041498 Bacteria 1013
109 Ga0451845_0554807 3300041501 Bacteria 755
110 Ga0451847_0740134 3300041503 Bacteria 755
111 Ga0451849_1206555 3300041505 Bacteria 1142
112 Ga0451851_0892928 3300041507 Unclassified 526
113 Ga0451843_0569794 3300041509 Bacteria 1083
114 Ga0451855_1089748 3300041511 Bacteria 740
115 Ga0451853_0530684 3300041512 Bacteria 1737
116 Ga0439431_0006879 3300041997 Bacteria 2526
117 Ga0439431_0103282 3300041997 Bacteria 785
118 Ga0439449_0171981 3300042007 Unclassified 809
119 Ga0439455_0233010 3300042012 Bacteria 537
120 Ga0450898_047327 3300042134 Bacteria 825
121 Ga0439435_0174396 3300042436 Unclassified 700
122 Ga0439435_0286658 3300042436 Bacteria 561
123 Ga0439464_0102163 3300042439 Bacteria 872
124 Ga0450893_0092969 3300042532 Unclassified 607
125 Ga0451577_0186087 3300042876 Bacteria 1873
126 Ga0453684_1359452 3300044712 Bacteria 738
127 Ga0451576_0740060 3300045051 Bacteria 1033
128 Ga0495610_0020304 3300046512 Bacteria 3691
129 Ga0495620_0217140 3300046515 Unclassified 732
130 Ga0495632_0122649 3300046519 Bacteria 1213
131 Ga0495643_0022204 3300046522 Bacteria 3624
132 Ga0495597_0366561 3300046542 Unclassified 551
133 Ga0495625_0004586 3300046660 Bacteria 12993
134 Ga0495686_0331008 3300047472 Unclassified 832
135 Ga0496118_0087144 3300048921 Bacteria 2167
136 Ga0496121_0262847 3300048924 Bacteria 1190
137 Ga0496124_0000125 3300048927 Bacteria 159942
138 Ga0496125_0009991 3300048928 Bacteria 9645
139 Ga0496125_0142318 3300048928 Bacteria 1665
140 Ga0496125_0174537 3300048928 Bacteria 1440
141 Ga0501308_066107 3300049128 Bacteria 554
142 Ga0501198_000008 3300049649 Bacteria 129023
143 Ga0501222_000006 3300049662 Bacteria 129030
144 nmdc:mga03n38_501718_c1 3300050490 Bacteria 681
145 nmdc:mga0k408_193550_c1 3300050493 Bacteria 822
146 nmdc:mga0k408_223621_c1 3300050493 Bacteria 1124
147 nmdc:mga0k408_255344_c1 3300050493 Bacteria 1047
148 nmdc:mga0k408_333889_c1 3300050493 Bacteria 904
149 nmdc:mga0k408_95461_c1 3300050493 Bacteria 1750
150 nmdc:mga06z11_205313_c1 3300050494 Bacteria 1146
151 nmdc:mga04h51_138074_c1 3300050495 Unclassified 922
152 nmdc:mga07m45_223051_c1 3300050496 Bacteria 1097
153 nmdc:mga07m45_85676_c1 3300050496 Bacteria 1802
154 nmdc:mga05p37_1557190_c1 3300050507 Bacteria 654
155 nmdc:mga05p37_328828_c1 3300050507 Bacteria 1806
156 nmdc:mga05p37_390311_c1 3300050507 Bacteria 1628
157 nmdc:mga09592_13467_c1 3300050508 Bacteria 6677
158 nmdc:mga09592_2271_c1 3300050508 Bacteria 15486
159 nmdc:mga0qj67_134653_c1 3300050509 Bacteria 2002
160 nmdc:mga06r32_1982675_c1 3300050510 Bacteria 516
161 nmdc:mga08y16_1190287_c1 3300050511 Unclassified 733
162 nmdc:mga0sz30_418080_c1 3300050516 Unclassified 601
163 Ga0500658_0011706 3300053134 Unclassified 3232
164 Ga0500590_027307 3300053148 Bacteria 2960
165 Ga0500590_048519 3300053148 Bacteria 2164
166 Ga0500627_0205138 3300053158 Bacteria 883
167 Ga0500587_005160 3300053739 Bacteria 1767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10021951 Ga0075365_100219512 65
2 3300005295 Ga0065707_10224498 Ga0065707_102244983 67
3 3300006846 Ga0075430_101126468 Ga0075430_1011264682 67
4 3300006880 Ga0075429_101448895 Ga0075429_1014488951 67
5 3300031911 Ga0307412_10792297 Ga0307412_107922972 67
6 3300050493 nmdc:mga0k408_193550_c1 nmdc:mga0k408_193550_c1_419_622 67
7 3300006846 Ga0075430_100025210 Ga0075430_1000252104 68
8 3300006880 Ga0075429_100000203 Ga0075429_10000020314 68
9 3300009147 Ga0114129_12387500 Ga0114129_123875001 68
10 3300050494 nmdc:mga06z11_205313_c1 nmdc:mga06z11_205313_c1_229_435 68
11 3300050507 nmdc:mga05p37_1557190_c1 nmdc:mga05p37_1557190_c1_151_357 68
12 3300050508 nmdc:mga09592_2271_c1 nmdc:mga09592_2271_c1_5081_5287 68
13 3300050509 nmdc:mga0qj67_134653_c1 nmdc:mga0qj67_134653_c1_392_598 68
14 iso_pu_bacteria 2585428062 2587756307 68
15 3300005367 Ga0070667_100823779 Ga0070667_1008237792 69
16 3300005456 Ga0070678_100203049 Ga0070678_1002030493 69
17 3300005539 Ga0068853_100079770 Ga0068853_1000797703 69
18 3300005548 Ga0070665_101021919 Ga0070665_1010219192 69
19 3300005616 Ga0068852_100357313 Ga0068852_1003573132 69
20 3300005843 Ga0068860_100634928 Ga0068860_1006349282 69
21 3300009093 Ga0105240_10078074 Ga0105240_100780744 69
22 3300009545 Ga0105237_10002045 Ga0105237_1000204521 69
23 3300009551 Ga0105238_10001158 Ga0105238_100011582 69
24 3300009553 Ga0105249_12432594 Ga0105249_124325942 69
25 3300010375 Ga0105239_10004965 Ga0105239_100049659 69
26 3300025913 Ga0207695_10004136 Ga0207695_1000413620 69
27 3300025914 Ga0207671_10004715 Ga0207671_100047156 69
28 3300025924 Ga0207694_10161435 Ga0207694_101614353 69
29 3300025961 Ga0207712_11137798 Ga0207712_111377981 69
30 3300026041 Ga0207639_10044424 Ga0207639_100444243 69
31 3300026121 Ga0207683_10192575 Ga0207683_101925753 69
32 3300026142 Ga0207698_10307391 Ga0207698_103073912 69
33 3300028381 Ga0268264_12565889 Ga0268264_125658891 69
34 3300048928 Ga0496125_0142318 Ga0496125_0142318_1294_1503 69
35 3300005338 Ga0068868_100110536 Ga0068868_1001105362 70
36 3300026023 Ga0207677_10793200 Ga0207677_107932002 70
37 3300048927 Ga0496124_0000125 Ga0496124_0000125_92285_92497 70
38 3300048928 Ga0496125_0009991 Ga0496125_0009991_2192_2404 70
39 3300005367 Ga0070667_101935964 Ga0070667_1019359641 71
40 3300005459 Ga0068867_100000005 Ga0068867_100000005144 71
41 3300005616 Ga0068852_100025758 Ga0068852_1000257584 71
42 3300005843 Ga0068860_100229446 Ga0068860_1002294462 71
43 3300014969 Ga0157376_11094518 Ga0157376_110945182 71
44 3300025935 Ga0207709_10003616 Ga0207709_1000361610 71
45 3300025986 Ga0207658_10545213 Ga0207658_105452132 71
46 3300026089 Ga0207648_10000032 Ga0207648_10000032105 71
47 3300026142 Ga0207698_10020858 Ga0207698_100208583 71
48 3300028381 Ga0268264_10343365 Ga0268264_103433652 71
49 3300041410 Ga0439461_0073328 Ga0439461_0073328_405_620 71
50 3300041997 Ga0439431_0103282 Ga0439431_0103282_255_470 71
51 3300042532 Ga0450893_0092969 Ga0450893_0092969_46_261 71
52 3300045051 Ga0451576_0740060 Ga0451576_0740060_408_623 71
53 3300048921 Ga0496118_0087144 Ga0496118_0087144_1323_1538 71
54 3300048924 Ga0496121_0262847 Ga0496121_0262847_37_252 71
55 3300048928 Ga0496125_0174537 Ga0496125_0174537_691_906 71
56 3300050511 nmdc:mga08y16_1190287_c1 nmdc:mga08y16_1190287_c1_460_675 71
57 3300005356 Ga0070674_100982246 Ga0070674_1009822462 72
58 3300005364 Ga0070673_102132557 Ga0070673_1021325571 72
59 3300005459 Ga0068867_100223015 Ga0068867_1002230152 72
60 3300005543 Ga0070672_100936208 Ga0070672_1009362082 72
61 3300005843 Ga0068860_100141342 Ga0068860_1001413423 72
62 3300006051 Ga0075364_10245889 Ga0075364_102458892 72
63 3300006186 Ga0075369_10296177 Ga0075369_102961772 72
64 3300006195 Ga0075366_10002486 Ga0075366_100024869 72
65 3300006195 Ga0075366_10008372 Ga0075366_100083724 72
66 3300006353 Ga0075370_10231142 Ga0075370_102311422 72
67 3300009147 Ga0114129_10333536 Ga0114129_103335363 72
68 3300025960 Ga0207651_11950528 Ga0207651_119505281 72
69 3300026089 Ga0207648_10674916 Ga0207648_106749162 72
70 3300026121 Ga0207683_10323688 Ga0207683_103236881 72
71 3300028381 Ga0268264_11049407 Ga0268264_110494072 72
72 3300028794 Ga0307515_10009057 Ga0307515_1000905711 72
73 3300031456 Ga0307513_10028714 Ga0307513_100287149 72
74 3300031507 Ga0307509_10252461 Ga0307509_102524613 72
75 3300031507 Ga0307509_10713744 Ga0307509_107137442 72
76 3300031649 Ga0307514_10282696 Ga0307514_102826962 72
77 3300031730 Ga0307516_10019389 Ga0307516_100193895 72
78 3300031730 Ga0307516_10294892 Ga0307516_102948923 72
79 3300041443 Ga0451789_0626469 Ga0451789_0626469_504_722 72
80 3300041451 Ga0451791_0379872 Ga0451791_0379872_379_597 72
81 3300041452 Ga0451793_1727319 Ga0451793_1727319_171_389 72
82 3300041456 Ga0451795_1349654 Ga0451795_1349654_465_683 72
83 3300041459 Ga0451800_0303826 Ga0451800_0303826_667_885 72
84 3300041460 Ga0451802_1146150 Ga0451802_1146150_271_489 72
85 3300041492 Ga0451835_0817551 Ga0451835_0817551_470_688 72
86 3300041496 Ga0451839_0505753 Ga0451839_0505753_433_651 72
87 3300041498 Ga0451841_0426578 Ga0451841_0426578_492_710 72
88 3300041501 Ga0451845_0554807 Ga0451845_0554807_99_317 72
89 3300041503 Ga0451847_0740134 Ga0451847_0740134_299_517 72
90 3300041505 Ga0451849_1206555 Ga0451849_1206555_680_898 72
91 3300041507 Ga0451851_0892928 Ga0451851_0892928_70_288 72
92 3300041509 Ga0451843_0569794 Ga0451843_0569794_280_498 72
93 3300041511 Ga0451855_1089748 Ga0451855_1089748_456_674 72
94 3300041512 Ga0451853_0530684 Ga0451853_0530684_984_1202 72
95 3300042436 Ga0439435_0286658 Ga0439435_0286658_58_285 72
96 3300046512 Ga0495610_0020304 Ga0495610_0020304_224_442 72
97 3300046515 Ga0495620_0217140 Ga0495620_0217140_212_430 72
98 3300046519 Ga0495632_0122649 Ga0495632_0122649_446_664 72
99 3300046522 Ga0495643_0022204 Ga0495643_0022204_2158_2376 72
100 3300046542 Ga0495597_0366561 Ga0495597_0366561_321_539 72
101 3300046660 Ga0495625_0004586 Ga0495625_0004586_11737_11955 72
102 3300047472 Ga0495686_0331008 Ga0495686_0331008_258_476 72
103 3300049649 Ga0501198_000008 Ga0501198_000008_62231_62449 72
104 3300049662 Ga0501222_000006 Ga0501222_000006_66595_66813 72
105 3300050493 nmdc:mga0k408_255344_c1 nmdc:mga0k408_255344_c1_162_380 72
106 3300050495 nmdc:mga04h51_138074_c1 nmdc:mga04h51_138074_c1_448_666 72
107 3300050496 nmdc:mga07m45_223051_c1 nmdc:mga07m45_223051_c1_835_1053 72
108 3300050496 nmdc:mga07m45_85676_c1 nmdc:mga07m45_85676_c1_258_476 72
109 3300050507 nmdc:mga05p37_328828_c1 nmdc:mga05p37_328828_c1_583_801 72
110 3300050516 nmdc:mga0sz30_418080_c1 nmdc:mga0sz30_418080_c1_53_271 72
111 3300053134 Ga0500658_0011706 Ga0500658_0011706_2580_2798 72
112 3300053158 Ga0500627_0205138 Ga0500627_0205138_162_380 72
113 3300053739 Ga0500587_005160 Ga0500587_005160_1142_1360 72
114 3300005328 Ga0070676_10709198 Ga0070676_107091983 73
115 3300005367 Ga0070667_100140979 Ga0070667_1001409793 73
116 3300005445 Ga0070708_100355627 Ga0070708_1003556273 73
117 3300005455 Ga0070663_100013312 Ga0070663_1000133122 73
118 3300005459 Ga0068867_100940806 Ga0068867_1009408062 73
119 3300005467 Ga0070706_100078703 Ga0070706_1000787031 73
120 3300005841 Ga0068863_102239564 Ga0068863_1022395641 73
121 3300005844 Ga0068862_100848180 Ga0068862_1008481802 73
122 3300006195 Ga0075366_10037243 Ga0075366_100372434 73
123 3300006195 Ga0075366_10039499 Ga0075366_100394994 73
124 3300006195 Ga0075366_10334542 Ga0075366_103345422 73
125 3300009093 Ga0105240_11964958 Ga0105240_119649581 73
126 3300013100 Ga0157373_11407378 Ga0157373_114073782 73
127 3300013297 Ga0157378_10360486 Ga0157378_103604863 73
128 3300014968 Ga0157379_10963987 Ga0157379_109639871 73
129 3300025903 Ga0207680_10350245 Ga0207680_103502452 73
130 3300025910 Ga0207684_10437376 Ga0207684_104373761 73
131 3300025931 Ga0207644_10505161 Ga0207644_105051612 73
132 3300025986 Ga0207658_10930765 Ga0207658_109307652 73
133 3300026023 Ga0207677_11797110 Ga0207677_117971101 73
134 3300026067 Ga0207678_10130026 Ga0207678_101300263 73
135 3300026088 Ga0207641_12317871 Ga0207641_123178711 73
136 3300026089 Ga0207648_11181505 Ga0207648_111815052 73
137 3300041452 Ga0451793_1622299 Ga0451793_1622299_43_264 73
138 3300041496 Ga0451839_0313634 Ga0451839_0313634_87_308 73
139 3300042012 Ga0439455_0233010 Ga0439455_0233010_192_416 73
140 3300042436 Ga0439435_0174396 Ga0439435_0174396_190_411 73
141 3300042876 Ga0451577_0186087 Ga0451577_0186087_652_873 73
142 3300044712 Ga0453684_1359452 Ga0453684_1359452_498_719 73
143 3300050490 nmdc:mga03n38_501718_c1 nmdc:mga03n38_501718_c1_442_663 73
144 3300050493 nmdc:mga0k408_223621_c1 nmdc:mga0k408_223621_c1_530_751 73
145 3300050493 nmdc:mga0k408_333889_c1 nmdc:mga0k408_333889_c1_611_832 73
146 3300050493 nmdc:mga0k408_95461_c1 nmdc:mga0k408_95461_c1_87_353 73
147 3300053148 Ga0500590_027307 Ga0500590_027307_1715_1936 73
148 3300053148 Ga0500590_048519 Ga0500590_048519_1023_1244 73
149 3300003347 JGI26128J50194_1003478 JGI26128J50194_10034782 74
150 3300009147 Ga0114129_10543289 Ga0114129_105432893 74
151 3300009147 Ga0114129_12182105 Ga0114129_121821052 74
152 3300014745 Ga0157377_10000022 Ga0157377_1000002228 74
153 3300027378 Ga0209981_1056481 Ga0209981_10564812 74
154 3300027395 Ga0209996_1005952 Ga0209996_10059521 74
155 3300027471 Ga0209995_1023182 Ga0209995_10231822 74
156 3300027526 Ga0209968_1001694 Ga0209968_10016945 74
157 3300027695 Ga0209966_1000090 Ga0209966_100009025 74
158 3300027717 Ga0209998_10029035 Ga0209998_100290352 74
159 3300041406 Ga0439439_0054539 Ga0439439_0054539_130_357 74
160 3300041460 Ga0451802_0537001 Ga0451802_0537001_625_945 74
161 3300041997 Ga0439431_0006879 Ga0439431_0006879_2092_2337 74
162 3300042007 Ga0439449_0171981 Ga0439449_0171981_261_488 74
163 3300042134 Ga0450898_047327 Ga0450898_047327_198_425 74
164 3300042439 Ga0439464_0102163 Ga0439464_0102163_552_788 74
165 3300049128 Ga0501308_066107 Ga0501308_066107_28_252 74
166 3300050507 nmdc:mga05p37_390311_c1 nmdc:mga05p37_390311_c1_1062_1298 74
167 3300050508 nmdc:mga09592_13467_c1 nmdc:mga09592_13467_c1_2828_3055 74
168 3300050510 nmdc:mga06r32_1982675_c1 nmdc:mga06r32_1982675_c1_194_421 74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fgg-assembly1.cif.gz_A crystal structure of putative ecf-type sigma factor negative effector from bacillus cereus 0.7871 34 63
5tw9-assembly1.cif.gz_B 1.50 angstrom crystal structure of c-terminal fragment (residues 322-384) of iron uptake system component efeo from yersinia pestis. 0.5199 34 63
5y4o-assembly1.cif.gz_A cryo-em structure of mscs channel, ynai 0.4518 43 74
4m2i-assembly2.cif.gz_D crystal structure of non-heme iron oxygenase orfp in complex with fe 0.4487 33 72
7bhi-assembly1.cif.gz_B crystal structure of recj-cdc45 from methanothermobacter thermoautotrophicus 0.4477 20 71
ID Description Score Start End Superfamily
3qkrB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6327 25 63 3.40.50.300
af_Q84JE8_157_266_3.30.1740.10 Alpha Beta;2-Layer Sandwich;first zn-finger domain of poly(adp-ribose) polymerase-1;Zinc finger, PARP-type 0.6101 31 63 3.30.1740.10
af_B6TVT9_90_185_1.25.40.20 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Ankyrin repeat-containing domain 0.5108 20 58 1.25.40.20
af_Q04399_377_564_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.5028 14 70 2.60.40.420
af_Q5AKW3_49_215_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.4723 21 64 2.40.50.90
ID Description Score Start End GO Terms
AF-A0A4P6GSA5-F1-model_v4 Uncharacterized protein 0.8503 15 74
AF-A0A848FEJ1-F1-model_v4 Uncharacterized protein 0.8394 14 74
AF-A0A520BY96-F1-model_v4 SMP-30/gluconolactonase/LRE family protein 0.8389 15 70
AF-A0A8B6LXN1-F1-model_v4 Uncharacterized protein 0.83 14 73
AF-A0A7W5DE73-F1-model_v4 Uncharacterized protein 0.8128 15 74

Feature Viewer

pLDDT pTM Quality
71.96 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map