F252300

General Info

Members Datasets Scaffolds Average Seq Length
168 120 336 216

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100012258|Ga0068860_1000122586
Length 228
Sequence MWRDLRLVAAKDLRIEQRSRVLTTQVAPFALMVLILFAFALDPDRGILESASPGLFWVTVLFVSLSAVQRSFAIEVADGGRDLLRLSGLEPAAIFLGKALALAVQLAVLEVLLFAGVVVLYGTDLKAGGVALALATAVTATIGLATAGTLYGALAAGLRVRDTLLPLLLLPIXTPVLLGCTRAFEAALGTTVGTPISDGWPWVALLVLFALVYTAGGAVAFGPLLEDA

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
32 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
33 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
34 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
43 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
47 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
48 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
49 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
50 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
51 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
52 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
53 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
54 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
55 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
56 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
57 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
58 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
59 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
60 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
61 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
64 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
67 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
72 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
76 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
77 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
82 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
83 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
84 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
85 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
86 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
98 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
102 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
103 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
106 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
107 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
110 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
111 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
114 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
115 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 5.95
Rhizosphere 82.74
Stem 0
Stem Tuber 0
Unclassified 10.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100012258 3300005843 Bacteria 8448
2 Ga0070670_100081165 3300005331 Bacteria 2787
3 Ga0070689_100450385 3300005340 Unclassified 1095
4 Ga0070713_100108788 3300005436 Bacteria 2414
5 Ga0070700_100110321 3300005441 Bacteria 1828
6 Ga0070706_100338033 3300005467 Bacteria 1404
7 Ga0070699_100252696 3300005518 Bacteria 1575
8 Ga0070697_100402862 3300005536 Bacteria 1187
9 Ga0068853_100726718 3300005539 Bacteria 948
10 Ga0068855_100049149 3300005563 Bacteria 4975
11 Ga0068856_101020259 3300005614 Bacteria 845
12 Ga0068863_100533339 3300005841 Bacteria 1158
13 Ga0068863_100709799 3300005841 Bacteria 1000
14 Ga0068858_100002996 3300005842 Bacteria 16933
15 Ga0068858_100120535 3300005842 Bacteria 2453
16 Ga0068860_100232736 3300005843 Bacteria 1791
17 Ga0075363_100140036 3300006048 Bacteria 1361
18 Ga0075362_10034316 3300006177 Bacteria 2211
19 Ga0075428_100000002 3300006844 Bacteria 546374
20 Ga0075428_100357910 3300006844 Bacteria 1566
21 Ga0075428_100373554 3300006844 Bacteria 1529
22 Ga0075430_100031306 3300006846 Bacteria 4515
23 Ga0075430_100232956 3300006846 Bacteria 1527
24 Ga0075431_100001195 3300006847 Bacteria 23439
25 Ga0075434_100332857 3300006871 Bacteria 1539
26 Ga0075429_100003115 3300006880 Bacteria 14087
27 Ga0075435_100587072 3300007076 Bacteria 966
28 Ga0111539_10001380 3300009094 Bacteria 32281
29 Ga0111539_10576718 3300009094 Bacteria 1310
30 Ga0105245_10154309 3300009098 Bacteria 2174
31 Ga0105247_10332654 3300009101 Unclassified 1063
32 Ga0114129_10050702 3300009147 Bacteria 5829
33 Ga0105249_10818073 3300009553 Unclassified 996
34 Ga0157369_10814473 3300013105 Bacteria 959
35 Ga0157375_10548694 3300013308 Unclassified 1318
36 Ga0157375_10968615 3300013308 Unclassified 992
37 Ga0163163_10121460 3300014325 Bacteria 2646
38 Ga0163163_10328557 3300014325 Bacteria 1583
39 Ga0157380_10258754 3300014326 Bacteria 1580
40 Ga0182008_10006169 3300014497 Bacteria 6735
41 Ga0157379_10072196 3300014968 Bacteria 3088
42 Ga0213873_10012428 3300021358 Bacteria 1845
43 Ga0213873_10030340 3300021358 Bacteria 1338
44 Ga0213876_10068179 3300021384 Bacteria 1879
45 Ga0213875_10125691 3300021388 Bacteria 1198
46 Ga0213875_10232220 3300021388 Unclassified 869
47 Ga0207645_10306275 3300025907 Bacteria 1058
48 Ga0207684_10464353 3300025910 Bacteria 1086
49 Ga0207707_10230551 3300025912 Bacteria 1611
50 Ga0207650_10085502 3300025925 Bacteria 2400
51 Ga0207703_10003513 3300026035 Bacteria 13110
52 Ga0207703_10112833 3300026035 Bacteria 2323
53 Ga0207703_10662976 3300026035 Bacteria 990
54 Ga0207641_10215605 3300026088 Bacteria 1777
55 Ga0207641_10317797 3300026088 Bacteria 1476
56 Ga0207428_10019667 3300027907 Bacteria 5755
57 Ga0268266_10082121 3300028379 Bacteria 2811
58 Ga0268264_10015800 3300028381 Bacteria 6180
59 Ga0268264_10191942 3300028381 Bacteria 1863
60 Ga0265336_10020037 3300028666 Bacteria 2151
61 Ga0265327_10000106 3300031251 Bacteria 184297
62 Ga0265327_10079349 3300031251 Bacteria 1625
63 Ga0373930_0005484 3300034816 Bacteria 2112
64 Ga0373948_0006256 3300034817 Bacteria 1963
65 Ga0373928_0000224 3300035084 Bacteria 11011
66 Ga0373929_0019263 3300035085 Bacteria 1365
67 Ga0373949_0036013 3300035090 Bacteria 1199
68 Ga0373932_0000134 3300035112 Bacteria 20925
69 Ga0373932_0013387 3300035112 Bacteria 2039
70 Ga0373955_0025752 3300035172 Bacteria 3024
71 Ga0373931_0000029 3300035691 Bacteria 116290
72 Ga0373931_0000033 3300035691 Bacteria 94739
73 Ga0373931_0111635 3300035691 Bacteria 1552
74 Ga0436364_1034367 3300037853 Unclassified 1778
75 Ga0436364_1131762 3300037853 Unclassified 869
76 Ga0436364_1343785 3300037853 Unclassified 1166
77 Ga0436365_0155384 3300039437 Bacteria 12736
78 Ga0436365_1603016 3300039437 Bacteria 8144
79 Ga0436361_0627904 3300039447 Bacteria 2241
80 Ga0436363_0444188 3300039450 Bacteria 1020
81 Ga0436362_0266209 3300039453 Bacteria 5528
82 Ga0436362_0377692 3300039453 Bacteria 2988
83 Ga0451837_0752160 3300041494 Bacteria 1652
84 Ga0451853_0545390 3300041512 Bacteria 772
85 Ga0466966_0315552 3300044684 Unclassified 939
86 Ga0466960_0300766 3300044901 Bacteria 904
87 Ga0466958_0493291 3300045836 Unclassified 795
88 Ga0495592_0217932 3300046454 Bacteria 1278
89 Ga0495629_0157314 3300046459 Bacteria 1579
90 Ga0495629_0188563 3300046459 Bacteria 1428
91 Ga0495629_0387418 3300046459 Bacteria 951
92 Ga0495641_0300314 3300046461 Bacteria 724
93 Ga0495651_0097972 3300046462 Bacteria 2189
94 Ga0495651_0333264 3300046462 Bacteria 1008
95 Ga0495653_0106587 3300046463 Bacteria 2021
96 Ga0495653_0303230 3300046463 Bacteria 1041
97 Ga0495608_0015022 3300046511 Bacteria 5374
98 Ga0495608_0204737 3300046511 Bacteria 1242
99 Ga0495628_0173332 3300046516 Bacteria 1635
100 Ga0495628_0341042 3300046516 Bacteria 1103
101 Ga0495630_0288197 3300046517 Bacteria 1255
102 Ga0495630_0378037 3300046517 Bacteria 1085
103 Ga0495587_0180560 3300046536 Bacteria 1197
104 Ga0495667_0149598 3300046559 Bacteria 1503
105 Ga0495658_0521191 3300046683 Unclassified 761
106 Ga0495600_0195431 3300046809 Bacteria 1300
107 Ga0495672_0007420 3300047320 Bacteria 8249
108 Ga0495680_0107464 3300047322 Bacteria 2072
109 Ga0495684_0232486 3300047471 Bacteria 1348
110 Ga0495684_0265715 3300047471 Bacteria 1243
111 Ga0496102_0177526 3300048905 Bacteria 2006
112 Ga0496103_0347759 3300048906 Unclassified 953
113 Ga0496104_0067572 3300048907 Bacteria 3396
114 Ga0496110_0043695 3300048913 Bacteria 3913
115 Ga0496110_0202089 3300048913 Bacteria 1806
116 Ga0496110_1065472 3300048913 Bacteria 716
117 Ga0496114_0003398 3300048917 Bacteria 12222
118 Ga0496114_0096346 3300048917 Bacteria 2519
119 Ga0496114_0356588 3300048917 Unclassified 1294
120 Ga0496115_0326740 3300048918 Bacteria 1254
121 Ga0501031_0014570 3300049568 Bacteria 5114
122 Ga0501034_0000952 3300049571 Bacteria 41839
123 Ga0501034_0026211 3300049571 Bacteria 5936
124 Ga0501034_0068081 3300049571 Bacteria 3572
125 Ga0501036_0656144 3300049572 Bacteria 868
126 Ga0501037_0592775 3300049573 Bacteria 745
127 Ga0501038_0157413 3300049574 Bacteria 1849
128 Ga0501038_0219426 3300049574 Unclassified 1518
129 Ga0501041_0241559 3300049577 Bacteria 1135
130 Ga0501042_0516634 3300049578 Bacteria 867
131 Ga0501046_0031282 3300049580 Bacteria 4316
132 Ga0501047_0543694 3300049581 Bacteria 986
133 Ga0501048_0399932 3300049582 Unclassified 982
134 Ga0501067_0131798 3300049583 Bacteria 1391
135 Ga0501068_0266845 3300049584 Bacteria 1092
136 Ga0501068_0358011 3300049584 Bacteria 938
137 Ga0501068_0388896 3300049584 Bacteria 899
138 Ga0501069_0033175 3300049585 Bacteria 2843
139 Ga0501071_0175546 3300049587 Bacteria 1605
140 Ga0501072_0213442 3300049588 Bacteria 1538
141 Ga0501076_0100857 3300049592 Bacteria 2326
142 Ga0501076_0181238 3300049592 Bacteria 1717
143 Ga0501081_0088072 3300049743 Bacteria 2181
144 Ga0501081_0091456 3300049743 Bacteria 2140
145 Ga0501044_0019119 3300049823 Bacteria 7334
146 Ga0501044_0289969 3300049823 Unclassified 1568
147 Ga0501044_0607679 3300049823 Bacteria 986
148 Ga0501045_0043927 3300049824 Bacteria 3255
149 Ga0501045_0216402 3300049824 Bacteria 1427
150 nmdc:mga03683_14977_c1 3300050489 Bacteria 2883
151 nmdc:mga03n38_56828_c1 3300050490 Bacteria 1767
152 nmdc:mga0yw44_216470_c1 3300050492 Bacteria 1268
153 nmdc:mga0yw44_73156_c1 3300050492 Bacteria 2132
154 nmdc:mga05p37_660191_c1 3300050507 Bacteria 1169
155 nmdc:mga09592_1032_c1 3300050508 Bacteria 22161
156 nmdc:mga0qj67_22461_c1 3300050509 Bacteria 4846
157 nmdc:mga06r32_920_c1 3300050510 Bacteria 26138
158 nmdc:mga08y16_18898_c1 3300050511 Bacteria 7257
159 nmdc:mga0sz30_59966_c1 3300050516 Bacteria 1624
160 Ga0495601_0200502 3300053077 Bacteria 1304
161 Ga0495595_0176888 3300053084 Bacteria 1057
162 Ga0495619_0143910 3300053085 Bacteria 1643
163 Ga0495619_0156190 3300053085 Bacteria 1574
164 Ga0500566_0000830 3300053094 Bacteria 17650
165 Ga0501084_0034626 3300054114 Bacteria 4222
166 Ga0501082_0094967 3300060353 Bacteria 2577
167 Ga0530510_0088117 3300061734 Bacteria 2262
168 Ga0530510_0228869 3300061734 Bacteria 1383
169 Ga0068860_100012258
170 Ga0070670_100081165
171 Ga0070689_100450385
172 Ga0070713_100108788
173 Ga0070700_100110321
174 Ga0070706_100338033
175 Ga0070699_100252696
176 Ga0070697_100402862
177 Ga0068853_100726718
178 Ga0068855_100049149
179 Ga0068856_101020259
180 Ga0068863_100533339
181 Ga0068863_100709799
182 Ga0068858_100002996
183 Ga0068858_100120535
184 Ga0068860_100232736
185 Ga0075363_100140036
186 Ga0075362_10034316
187 Ga0075428_100000002
188 Ga0075428_100357910
189 Ga0075428_100373554
190 Ga0075430_100031306
191 Ga0075430_100232956
192 Ga0075431_100001195
193 Ga0075434_100332857
194 Ga0075429_100003115
195 Ga0075435_100587072
196 Ga0111539_10001380
197 Ga0111539_10576718
198 Ga0105245_10154309
199 Ga0105247_10332654
200 Ga0114129_10050702
201 Ga0105249_10818073
202 Ga0157369_10814473
203 Ga0157375_10548694
204 Ga0157375_10968615
205 Ga0163163_10121460
206 Ga0163163_10328557
207 Ga0157380_10258754
208 Ga0182008_10006169
209 Ga0157379_10072196
210 Ga0213873_10012428
211 Ga0213873_10030340
212 Ga0213876_10068179
213 Ga0213875_10125691
214 Ga0213875_10232220
215 Ga0207645_10306275
216 Ga0207684_10464353
217 Ga0207707_10230551
218 Ga0207650_10085502
219 Ga0207703_10003513
220 Ga0207703_10112833
221 Ga0207703_10662976
222 Ga0207641_10215605
223 Ga0207641_10317797
224 Ga0207428_10019667
225 Ga0268266_10082121
226 Ga0268264_10015800
227 Ga0268264_10191942
228 Ga0265336_10020037
229 Ga0265327_10000106
230 Ga0265327_10079349
231 Ga0373930_0005484
232 Ga0373948_0006256
233 Ga0373928_0000224
234 Ga0373929_0019263
235 Ga0373949_0036013
236 Ga0373932_0000134
237 Ga0373932_0013387
238 Ga0373955_0025752
239 Ga0373931_0000029
240 Ga0373931_0000033
241 Ga0373931_0111635
242 Ga0436364_1034367
243 Ga0436364_1131762
244 Ga0436364_1343785
245 Ga0436365_0155384
246 Ga0436365_1603016
247 Ga0436361_0627904
248 Ga0436363_0444188
249 Ga0436362_0266209
250 Ga0436362_0377692
251 Ga0451837_0752160
252 Ga0451853_0545390
253 Ga0466966_0315552
254 Ga0466960_0300766
255 Ga0466958_0493291
256 Ga0495592_0217932
257 Ga0495629_0157314
258 Ga0495629_0188563
259 Ga0495629_0387418
260 Ga0495641_0300314
261 Ga0495651_0097972
262 Ga0495651_0333264
263 Ga0495653_0106587
264 Ga0495653_0303230
265 Ga0495608_0015022
266 Ga0495608_0204737
267 Ga0495628_0173332
268 Ga0495628_0341042
269 Ga0495630_0288197
270 Ga0495630_0378037
271 Ga0495587_0180560
272 Ga0495667_0149598
273 Ga0495658_0521191
274 Ga0495600_0195431
275 Ga0495672_0007420
276 Ga0495680_0107464
277 Ga0495684_0232486
278 Ga0495684_0265715
279 Ga0496102_0177526
280 Ga0496103_0347759
281 Ga0496104_0067572
282 Ga0496110_0043695
283 Ga0496110_0202089
284 Ga0496110_1065472
285 Ga0496114_0003398
286 Ga0496114_0096346
287 Ga0496114_0356588
288 Ga0496115_0326740
289 Ga0501031_0014570
290 Ga0501034_0000952
291 Ga0501034_0026211
292 Ga0501034_0068081
293 Ga0501036_0656144
294 Ga0501037_0592775
295 Ga0501038_0157413
296 Ga0501038_0219426
297 Ga0501041_0241559
298 Ga0501042_0516634
299 Ga0501046_0031282
300 Ga0501047_0543694
301 Ga0501048_0399932
302 Ga0501067_0131798
303 Ga0501068_0266845
304 Ga0501068_0358011
305 Ga0501068_0388896
306 Ga0501069_0033175
307 Ga0501071_0175546
308 Ga0501072_0213442
309 Ga0501076_0100857
310 Ga0501076_0181238
311 Ga0501081_0088072
312 Ga0501081_0091456
313 Ga0501044_0019119
314 Ga0501044_0289969
315 Ga0501044_0607679
316 Ga0501045_0043927
317 Ga0501045_0216402
318 nmdc:mga03683_14977_c1
319 nmdc:mga03n38_56828_c1
320 nmdc:mga0yw44_216470_c1
321 nmdc:mga0yw44_73156_c1
322 nmdc:mga05p37_660191_c1
323 nmdc:mga09592_1032_c1
324 nmdc:mga0qj67_22461_c1
325 nmdc:mga06r32_920_c1
326 nmdc:mga08y16_18898_c1
327 nmdc:mga0sz30_59966_c1
328 Ga0495601_0200502
329 Ga0495595_0176888
330 Ga0495619_0143910
331 Ga0495619_0156190
332 Ga0500566_0000830
333 Ga0501084_0034626
334 Ga0501082_0094967
335 Ga0530510_0088117
336 Ga0530510_0228869

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03379

CcmB

CcmB protein

5

224

0.86

PF01061

ABC2_membrane

ABC-2 type transporter

5

175

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.8158 8 208
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.7925 8 208
8ce1-assembly1.cif.gz_B cytochrome c maturation complex ccmabcd 0.7818 8 208
7f02-assembly1.cif.gz_F cytochrome c-type biogenesis protein ccmabcd from e. coli 0.759 8 208
8i39-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with aba 0.6937 3 205
ID Description Score Start End Superfamily
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7044 39 201 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6264 39 196 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5689 39 201 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.4934 39 196 3.40.1710.10
af_A2AP89_1193_1388_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4448 114 208 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A3C1JJF8-F1-model_v4 deleted 0.9382 38 210
AF-A0A7K0JX46-F1-model_v4 deleted 0.9357 2 210
AF-A0A3C1JJF8-F1-model_v4 deleted 0.933 38 210
AF-A0A3D0TNT8-F1-model_v4 Heme exporter protein B 0.9317 3 210 GO:0005886
GO:0015232
GO:0017004
GO:1903607
AF-A0A7K0JX46-F1-model_v4 deleted 0.9271 2 210

Map