F251560

General Info

Members Datasets Scaffolds Average Seq Length
167 140 124 219

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2868088558|2868095012
Length 247
Sequence RLEDPAHEPSSAGGRPSGENDGPAPSRIRVLLADDHEPIRTALRFVLDGADDIEVVGEAADGSVAVTNARSLRPDVVLMDVRMPNVDGIGATREIVRDQLADVLVLTTFDLDEYVFGALRAGAAGFLLKTAEPAEILAAVRRVAAGDGVVAPEVTRRVLAALASPGTDEHDDGSDQARAADRLTELTARERDVLAALGAGLSNQEIAAKLVITEATAKTHVSRILTKLGCSSRVQAAILAREAGVIP

Samples

Sample ID Description Type Environment
1 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
2 2619618881 Frankia sp. ACN1ag Isolate Unclassified
3 2619619003 Frankia sp. CpI1-P Isolate Nodule
4 2643221647 Streptomyces sp. Root369 Isolate Unclassified
5 2671180195 Frankia sp. CcI49 Isolate Nodule
6 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
7 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2773857922 Frankia sp. CcI49 Isolate Nodule
9 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
10 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
11 2855683550 Micromonospora sp. RP3T Isolate Unclassified
12 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
13 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
14 2858882152 Micromonospora noduli MED15 Isolate Nodule
15 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
16 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
17 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
18 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
19 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
20 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
21 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
22 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
23 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
24 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
25 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
26 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
27 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
28 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
29 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
30 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
31 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
32 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
33 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
34 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
74 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
75 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
76 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
94 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
114 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
115 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
116 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
117 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
118 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
119 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
120 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
121 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
131 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
135 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
136 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
137 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
138 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
139 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
140 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 74.25
Metatranscriptomes 0
Isolates 25.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 5.99
Rhizoplane 3.59
Rhizosphere 56.89
Stem 0
Stem Tuber 0
Unclassified 32.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100248782 3300005329 Bacteria 1691
2 Ga0070683_100285032 3300005329 Bacteria 1571
3 Ga0070683_100671039 3300005329 Bacteria 992
4 Ga0070670_100422268 3300005331 Bacteria 1179
5 Ga0070675_100278727 3300005354 Bacteria 1469
6 Ga0070714_100011064 3300005435 Bacteria 7148
7 Ga0070713_100117909 3300005436 Bacteria 2323
8 Ga0070665_100077398 3300005548 Bacteria 3333
9 Ga0068854_100432858 3300005578 Bacteria 1095
10 Ga0068861_100437690 3300005719 Bacteria 1169
11 Ga0081538_10008987 3300005981 Bacteria 8395
12 Ga0081538_10013058 3300005981 Bacteria 6607
13 Ga0081538_10068006 3300005981 Bacteria 1984
14 Ga0081540_1034942 3300005983 Bacteria 2702
15 Ga0075367_10489395 3300006178 Bacteria 780
16 Ga0075428_100568164 3300006844 Bacteria 1212
17 Ga0075428_100856374 3300006844 Bacteria 965
18 Ga0075430_100457738 3300006846 Bacteria 1053
19 Ga0075433_10128713 3300006852 Bacteria 2249
20 Ga0111539_10004945 3300009094 Bacteria 17334
21 Ga0114129_10155872 3300009147 Bacteria 3123
22 Ga0105243_10797208 3300009148 Bacteria 931
23 Ga0105242_10438862 3300009176 Bacteria 1228
24 Ga0105248_11003603 3300009177 Bacteria 943
25 Ga0157372_10368617 3300013307 Bacteria 1673
26 Ga0157380_10415905 3300014326 Bacteria 1281
27 Ga0163161_10054851 3300017792 Bacteria 2893
28 Ga0213876_10177013 3300021384 Bacteria 1135
29 Ga0213875_10000404 3300021388 Bacteria 37933
30 Ga0213875_10088117 3300021388 Bacteria 1448
31 Ga0207685_10076205 3300025905 Bacteria 1374
32 Ga0207681_10132383 3300025923 Bacteria 1846
33 Ga0207659_10547561 3300025926 Bacteria 983
34 Ga0207700_10040981 3300025928 Bacteria 3384
35 Ga0207664_10005337 3300025929 Bacteria 8780
36 Ga0207690_10055755 3300025932 Bacteria 2663
37 Ga0207689_10327536 3300025942 Bacteria 1272
38 Ga0207679_10291108 3300025945 Bacteria 1404
39 Ga0207678_10572044 3300026067 Bacteria 989
40 Ga0207708_10035575 3300026075 Bacteria 3789
41 Ga0207708_10245607 3300026075 Bacteria 1441
42 Ga0207675_100290818 3300026118 Bacteria 1589
43 Ga0207675_100305349 3300026118 Bacteria 1551
44 Ga0207683_10385458 3300026121 Bacteria 1289
45 Ga0207698_10316325 3300026142 Bacteria 1460
46 Ga0207698_10876998 3300026142 Bacteria 903
47 Ga0207428_10035852 3300027907 Bacteria 4051
48 Ga0307511_10000088 3300030521 Bacteria 77229
49 Ga0307512_10131742 3300030522 Bacteria 1564
50 Ga0316177_1212099 3300030731 Bacteria 5526
51 Ga0316176_1111777 3300030732 Bacteria 7240
52 Ga0307513_10000280 3300031456 Bacteria 73785
53 Ga0307513_10013181 3300031456 Bacteria 10156
54 Ga0316575_10000004 3300031665 Bacteria 116505
55 Ga0307405_10307333 3300031731 Bacteria 1206
56 Ga0307413_10817963 3300031824 Bacteria 784
57 Ga0307410_10249252 3300031852 Bacteria 1380
58 Ga0307406_10033083 3300031901 Bacteria 3162
59 Ga0307406_10161362 3300031901 Bacteria 1612
60 Ga0307416_100240148 3300032002 Bacteria 1755
61 Ga0307415_100074148 3300032126 Bacteria 2404
62 Ga0307415_100108664 3300032126 Bacteria 2053
63 Ga0395900_0008127 3300037418 Bacteria 10803
64 Ga0395900_0310402 3300037418 Bacteria 1560
65 Ga0395898_0021156 3300037466 Bacteria 6599
66 Ga0395905_0022230 3300037471 Bacteria 6001
67 Ga0436364_0404541 3300037853 Bacteria 2205
68 Ga0436364_0464066 3300037853 Bacteria 4102
69 Ga0436364_1422884 3300037853 Bacteria 63821
70 Ga0395901_0006232 3300038443 Bacteria 12090
71 Ga0395901_0470703 3300038443 Bacteria 1283
72 Ga0436365_1300450 3300039437 Bacteria 3953
73 Ga0436365_1357340 3300039437 Bacteria 3152
74 Ga0436363_1179516 3300039450 Bacteria 1150
75 Ga0451791_0410328 3300041451 Bacteria 3219
76 Ga0451797_0634734 3300041453 Bacteria 1697
77 Ga0451843_1646821 3300041509 Bacteria 1025
78 Ga0466972_0001898 3300044658 Bacteria 10263
79 Ga0466965_0018494 3300044683 Bacteria 3341
80 Ga0466965_0149671 3300044683 Bacteria 1219
81 Ga0466963_0031092 3300044694 Bacteria 3449
82 Ga0466963_0035278 3300044694 Bacteria 3258
83 Ga0466963_0545602 3300044694 Bacteria 819
84 Ga0466968_0142432 3300044735 Bacteria 1097
85 Ga0466960_0047867 3300044901 Bacteria 2052
86 Ga0466967_0044424 3300045976 Bacteria 3854
87 Ga0495608_0194711 3300046511 Bacteria 1279
88 Ga0495587_0149045 3300046536 Bacteria 1333
89 Ga0495634_0203175 3300046642 Bacteria 1230
90 Ga0495624_0111971 3300046690 Bacteria 1678
91 Ga0495604_0038753 3300047317 Bacteria 3750
92 Ga0495676_0153447 3300047321 Bacteria 1636
93 Ga0495686_0285991 3300047472 Bacteria 915
94 Ga0495614_0150197 3300048089 Bacteria 1039
95 Ga0496107_0417072 3300048910 Bacteria 998
96 Ga0496109_0234588 3300048912 Bacteria 1727
97 Ga0496113_0079968 3300048916 Bacteria 2503
98 Ga0496114_0498782 3300048917 Bacteria 1077
99 Ga0496116_0029625 3300048919 Bacteria 3942
100 Ga0496117_0092912 3300048920 Bacteria 1936
101 Ga0496118_0004586 3300048921 Bacteria 16253
102 Ga0496118_0083048 3300048921 Bacteria 2241
103 Ga0496119_0031239 3300048922 Bacteria 3576
104 Ga0496119_0130721 3300048922 Bacteria 1368
105 Ga0496120_0001902 3300048923 Bacteria 23112
106 Ga0496122_0000065 3300048925 Bacteria 235242
107 Ga0496122_0000278 3300048925 Bacteria 114194
108 Ga0496123_0000006 3300048926 Bacteria 647258
109 Ga0496124_0013900 3300048927 Bacteria 7826
110 Ga0496125_0000094 3300048928 Bacteria 208341
111 Ga0496125_0001483 3300048928 Bacteria 33859
112 Ga0496126_0005124 3300048929 Bacteria 15176
113 Ga0501033_0060602 3300049570 Bacteria 2791
114 Ga0501034_0040457 3300049571 Bacteria 4719
115 Ga0501036_0020445 3300049572 Bacteria 5561
116 Ga0501038_0084998 3300049574 Bacteria 2662
117 nmdc:mga09592_295961_c1 3300050508 Bacteria 1403
118 nmdc:mga08y16_1095385_c1 3300050511 Bacteria 772
119 nmdc:mga08y16_55877_c1 3300050511 Bacteria 4125
120 nmdc:mga0n895_116940_c1 3300050512 Bacteria 2685
121 nmdc:mga08x19_180029_c1 3300050514 Bacteria 1443
122 nmdc:mga0a205_76937_c1 3300050515 Bacteria 3224
123 Ga0500616_0002007 3300053153 Bacteria 18019
124 Ga0590075_012336 3300059424 Bacteria 2074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0285991 Ga0495686_0285991_358_888 175
2 3300049571 Ga0501034_0040457 Ga0501034_0040457_3056_3733 193
3 3300049570 Ga0501033_0060602 Ga0501033_0060602_609_1283 194
4 3300049572 Ga0501036_0020445 Ga0501036_0020445_3364_4038 194
5 3300041509 Ga0451843_1646821 Ga0451843_1646821_35_634 198
6 3300049574 Ga0501038_0084998 Ga0501038_0084998_1279_1953 198
7 3300005435 Ga0070714_100011064 Ga0070714_1000110642 201
8 3300005436 Ga0070713_100117909 Ga0070713_1001179092 201
9 3300025928 Ga0207700_10040981 Ga0207700_100409812 201
10 3300025929 Ga0207664_10005337 Ga0207664_100053378 201
11 3300031901 Ga0307406_10161362 Ga0307406_101613622 202
12 3300032126 Ga0307415_100108664 Ga0307415_1001086642 202
13 3300050514 nmdc:mga08x19_180029_c1 nmdc:mga08x19_180029_c1_793_1404 202
14 iso_pu_bacteria 2897561785 2897564519 206
15 3300005981 Ga0081538_10008987 Ga0081538_1000898712 207
16 3300030731 Ga0316177_1212099 Ga0316177_12120995 208
17 3300030732 Ga0316176_1111777 Ga0316176_11117776 208
18 3300044658 Ga0466972_0001898 Ga0466972_0001898_3650_4279 208
19 3300044683 Ga0466965_0018494 Ga0466965_0018494_1109_1738 208
20 3300044683 Ga0466965_0149671 Ga0466965_0149671_390_1019 208
21 3300044735 Ga0466968_0142432 Ga0466968_0142432_60_689 208
22 3300044901 Ga0466960_0047867 Ga0466960_0047867_201_830 208
23 iso_pu_bacteria 8003870546 8003876943 209
24 3300005981 Ga0081538_10013058 Ga0081538_100130587 210
25 3300005981 Ga0081538_10068006 Ga0081538_100680062 210
26 3300048916 Ga0496113_0079968 Ga0496113_0079968_762_1403 211
27 3300048919 Ga0496116_0029625 Ga0496116_0029625_98_739 211
28 3300048921 Ga0496118_0004586 Ga0496118_0004586_8530_9171 211
29 3300048922 Ga0496119_0031239 Ga0496119_0031239_1908_2549 211
30 3300048923 Ga0496120_0001902 Ga0496120_0001902_15744_16385 211
31 3300048925 Ga0496122_0000065 Ga0496122_0000065_161937_162578 211
32 3300048926 Ga0496123_0000006 Ga0496123_0000006_351546_352187 211
33 3300048927 Ga0496124_0013900 Ga0496124_0013900_5882_6523 211
34 3300048928 Ga0496125_0001483 Ga0496125_0001483_9850_10491 211
35 3300048929 Ga0496126_0005124 Ga0496126_0005124_1249_1890 211
36 iso_pu_bacteria 8047710418 8047713949 211
37 3300030522 Ga0307512_10131742 Ga0307512_101317422 212
38 3300037418 Ga0395900_0008127 Ga0395900_0008127_5554_6246 212
39 3300037466 Ga0395898_0021156 Ga0395898_0021156_1506_2198 212
40 3300037471 Ga0395905_0022230 Ga0395905_0022230_340_1032 212
41 3300038443 Ga0395901_0006232 Ga0395901_0006232_8132_8824 212
42 3300044694 Ga0466963_0031092 Ga0466963_0031092_2059_2745 212
43 3300045976 Ga0466967_0044424 Ga0466967_0044424_1751_2437 212
44 3300025905 Ga0207685_10076205 Ga0207685_100762052 213
45 3300046536 Ga0495587_0149045 Ga0495587_0149045_569_1222 213
46 3300046642 Ga0495634_0203175 Ga0495634_0203175_114_767 213
47 3300046690 Ga0495624_0111971 Ga0495624_0111971_561_1214 213
48 3300047317 Ga0495604_0038753 Ga0495604_0038753_120_773 213
49 3300047321 Ga0495676_0153447 Ga0495676_0153447_121_774 213
50 3300048089 Ga0495614_0150197 Ga0495614_0150197_220_876 213
51 iso_pu_bacteria 2855683550 2855686437 213
52 iso_pu_bacteria 2868088558 2868095012 213
53 iso_pu_bacteria 2884994152 2884997314 213
54 3300013307 Ga0157372_10368617 Ga0157372_103686171 214
55 iso_pu_bacteria 2855670206 2855671339 214
56 iso_pu_bacteria 2855676851 2855678531 214
57 iso_pu_bacteria 2857288857 2857292036 214
58 iso_pu_bacteria 2858848962 2858850823 214
59 iso_pu_bacteria 2858882152 2858883804 214
60 iso_pu_bacteria 2858888857 2858890042 214
61 iso_pu_bacteria 2858895516 2858900977 214
62 iso_pu_bacteria 2869048445 2869050201 214
63 iso_pu_bacteria 2869061728 2869062505 214
64 iso_pu_bacteria 2869068681 2869070877 214
65 iso_pu_bacteria 2880489317 2880493333 214
66 iso_pu_bacteria 2880495981 2880498966 214
67 iso_pu_bacteria 2929219909 2929220985 214
68 iso_pu_bacteria 2929226422 2929227557 214
69 iso_pu_bacteria 2954380949 2954390283 214
70 iso_pu_bacteria 2990088156 2990092835 214
71 iso_pu_bacteria 8003870546 8003871377 214
72 iso_pu_bacteria 8054160619 8054163314 214
73 iso_pu_bacteria 8054704163 8054710796 214
74 3300025942 Ga0207689_10327536 Ga0207689_103275362 215
75 3300025945 Ga0207679_10291108 Ga0207679_102911082 215
76 3300031665 Ga0316575_10000004 Ga0316575_1000000417 216
77 3300046511 Ga0495608_0194711 Ga0495608_0194711_223_879 216
78 3300050511 nmdc:mga08y16_1095385_c1 nmdc:mga08y16_1095385_c1_86_745 216
79 iso_pu_bacteria 2643221647 2644268748 216
80 iso_pu_bacteria 2867312974 2867315903 216
81 iso_pu_bacteria 2867319477 2867323630 216
82 iso_pu_bacteria 8033684223 8033685112 216
83 iso_pu_bacteria 8054727385 8054727449 216
84 3300006178 Ga0075367_10489395 Ga0075367_104893951 217
85 3300006844 Ga0075428_100568164 Ga0075428_1005681642 217
86 3300006852 Ga0075433_10128713 Ga0075433_101287132 217
87 3300009147 Ga0114129_10155872 Ga0114129_101558723 217
88 3300021388 Ga0213875_10000404 Ga0213875_1000040426 217
89 3300030521 Ga0307511_10000088 Ga0307511_1000008840 217
90 3300031456 Ga0307513_10000280 Ga0307513_100002808 217
91 3300031852 Ga0307410_10249252 Ga0307410_102492522 217
92 3300031901 Ga0307406_10033083 Ga0307406_100330833 217
93 3300037853 Ga0436364_1422884 Ga0436364_1422884_61244_62002 217
94 3300044694 Ga0466963_0035278 Ga0466963_0035278_2409_3068 217
95 3300048910 Ga0496107_0417072 Ga0496107_0417072_286_948 217
96 3300048912 Ga0496109_0234588 Ga0496109_0234588_246_914 217
97 3300050512 nmdc:mga0n895_116940_c1 nmdc:mga0n895_116940_c1_1965_2633 217
98 3300050515 nmdc:mga0a205_76937_c1 nmdc:mga0a205_76937_c1_336_1004 217
99 3300053153 Ga0500616_0002007 Ga0500616_0002007_4215_4871 217
100 iso_pu_bacteria 2579778521 2579855323 217
101 iso_pu_bacteria 2619618881 2619855999 217
102 iso_pu_bacteria 2619619003 2620350938 217
103 iso_pu_bacteria 2671180195 2671834685 217
104 iso_pu_bacteria 2675902999 2676204252 217
105 iso_pu_bacteria 2773857921 2774848828 217
106 iso_pu_bacteria 2773857922 2774852841 217
107 iso_pu_bacteria 2867302475 2867306858 217
108 iso_pu_bacteria 2869048445 2869052171 217
109 iso_pu_bacteria 8054734606 8054739756 217
110 3300037418 Ga0395900_0310402 Ga0395900_0310402_201_863 218
111 3300048920 Ga0496117_0092912 Ga0496117_0092912_689_1363 218
112 3300048921 Ga0496118_0083048 Ga0496118_0083048_864_1538 218
113 3300048922 Ga0496119_0130721 Ga0496119_0130721_155_838 218
114 3300048925 Ga0496122_0000278 Ga0496122_0000278_10410_11093 218
115 3300048928 Ga0496125_0000094 Ga0496125_0000094_173253_173975 218
116 iso_pu_bacteria 2858902515 2858908535 218
117 3300021384 Ga0213876_10177013 Ga0213876_101770132 219
118 3300031731 Ga0307405_10307333 Ga0307405_103073332 219
119 3300038443 Ga0395901_0470703 Ga0395901_0470703_313_978 219
120 3300039437 Ga0436365_1357340 Ga0436365_1357340_1564_2250 219
121 3300039450 Ga0436363_1179516 Ga0436363_1179516_160_846 219
122 3300059424 Ga0590075_012336 Ga0590075_012336_129_803 219
123 iso_pu_bacteria 2873314349 2873316074 219
124 iso_pu_bacteria 2891395885 2891397715 219
125 3300005354 Ga0070675_100278727 Ga0070675_1002787272 220
126 3300005548 Ga0070665_100077398 Ga0070665_1000773983 220
127 3300005719 Ga0068861_100437690 Ga0068861_1004376902 220
128 3300006846 Ga0075430_100457738 Ga0075430_1004577381 220
129 3300014326 Ga0157380_10415905 Ga0157380_104159052 220
130 3300021388 Ga0213875_10088117 Ga0213875_100881172 220
131 3300025923 Ga0207681_10132383 Ga0207681_101323832 220
132 3300025926 Ga0207659_10547561 Ga0207659_105475612 220
133 3300026075 Ga0207708_10035575 Ga0207708_100355753 220
134 3300026118 Ga0207675_100305349 Ga0207675_1003053492 220
135 3300026142 Ga0207698_10876998 Ga0207698_108769982 220
136 3300032002 Ga0307416_100240148 Ga0307416_1002401482 220
137 3300032126 Ga0307415_100074148 Ga0307415_1000741482 220
138 3300037853 Ga0436364_0404541 Ga0436364_0404541_1058_1753 220
139 3300037853 Ga0436364_0464066 Ga0436364_0464066_736_1431 220
140 3300039437 Ga0436365_1300450 Ga0436365_1300450_25_720 220
141 3300005329 Ga0070683_100248782 Ga0070683_1002487822 221
142 3300005329 Ga0070683_100285032 Ga0070683_1002850322 221
143 3300005329 Ga0070683_100671039 Ga0070683_1006710392 221
144 3300005331 Ga0070670_100422268 Ga0070670_1004222682 221
145 3300005578 Ga0068854_100432858 Ga0068854_1004328581 221
146 3300005983 Ga0081540_1034942 Ga0081540_10349422 221
147 3300006844 Ga0075428_100856374 Ga0075428_1008563742 221
148 3300009094 Ga0111539_10004945 Ga0111539_100049454 221
149 3300009148 Ga0105243_10797208 Ga0105243_107972081 221
150 3300009176 Ga0105242_10438862 Ga0105242_104388622 221
151 3300009177 Ga0105248_11003603 Ga0105248_110036031 221
152 3300017792 Ga0163161_10054851 Ga0163161_100548512 221
153 3300025932 Ga0207690_10055755 Ga0207690_100557551 221
154 3300026067 Ga0207678_10572044 Ga0207678_105720442 221
155 3300026075 Ga0207708_10245607 Ga0207708_102456071 221
156 3300026118 Ga0207675_100290818 Ga0207675_1002908182 221
157 3300026121 Ga0207683_10385458 Ga0207683_103854582 221
158 3300026142 Ga0207698_10316325 Ga0207698_103163251 221
159 3300027907 Ga0207428_10035852 Ga0207428_100358521 221
160 3300031456 Ga0307513_10013181 Ga0307513_100131812 221
161 3300031824 Ga0307413_10817963 Ga0307413_108179631 221
162 3300041451 Ga0451791_0410328 Ga0451791_0410328_1919_2590 221
163 3300041453 Ga0451797_0634734 Ga0451797_0634734_282_953 221
164 3300044694 Ga0466963_0545602 Ga0466963_0545602_105_776 221
165 3300048917 Ga0496114_0498782 Ga0496114_0498782_318_983 221
166 3300050508 nmdc:mga09592_295961_c1 nmdc:mga09592_295961_c1_381_1052 221
167 3300050511 nmdc:mga08y16_55877_c1 nmdc:mga08y16_55877_c1_327_998 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

30

141

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

184

240

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

176

228

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9872 155 215
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9842 154 215
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9824 154 215
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9822 154 215
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9812 154 214
ID Description Score Start End Superfamily
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9873 154 206 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9788 154 209 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9785 155 209 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9711 155 216 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.968 154 216 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7J9ZUF4-F1-model_v4 Response regulator 0.9783 1 121 GO:0000160
GO:0003677
AF-A0A850D035-F1-model_v4 deleted 0.9778 2 121
AF-A0A3N4YZ83-F1-model_v4 DNA-binding NarL/FixJ family response regulator 0.9674 21 216 GO:0000160
GO:0003677
GO:0006355
AF-A0A1C4SLV9-F1-model_v4 Two component transcriptional regulator, LuxR family 0.9656 1 220 GO:0000160
GO:0003677
GO:0006355
AF-A0A6J7IGP3-F1-model_v4 Unannotated protein 0.9641 2 119 GO:0000160

Feature Viewer

pLDDT pTM Quality
82.94 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map