F251359

General Info

Members Datasets Scaffolds Average Seq Length
167 135 334 354

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0012290|Ga0501069_0012290_3313_4509
Length 398
Sequence VSTTGPLAGLRILEVGHILAGPFATMLLADLGADVIKVESKTGDLSREVGSQYVDGHNVYFASINRNKRSVHIDLVTEEGQAQLHRLVRESDALLVNMRPSAIRKLGLDYASLSQVNPKIVCVAVTGFGLDGAEAEWPAFDYVIQAGVGLAAMTGDPDGPPMLPGYSAVDNSSAIMAALGLLAKVHEGKGGQVDVSLFDTMLSQLNYKAAAYLNGGVVPPRQPAGGHSFYVPAQLFPTAEGYLALFVTHDEFWRRLCDEIGEPGWGIDPRFATMHARNDNRAELIALLTTKLAEMSAVEWADRLRPLGLAVGAVVSLDHALDSDYVGRRGMVVTIPTDAGPLRMVGNPIRTEPSGDFTPPPRLHEHTPQLLGDQRGCAIRPAIATAIFHALARMCHPL

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
36 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
67 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
68 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
84 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
87 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
92 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
111 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
119 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
120 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
121 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
124 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
125 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
126 2671180195 Frankia sp. CcI49 Isolate Nodule
127 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
128 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
129 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
130 2773857922 Frankia sp. CcI49 Isolate Nodule
131 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
132 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
133 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
134 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
135 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 0
Isolates 7.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 2.4
Rhizoplane 4.19
Rhizosphere 76.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0012290 3300049585 Bacteria 4551
2 JGI24746J21847_1004471 3300001977 Bacteria 2203
3 JGI24744J21845_10025205 3300002077 Bacteria 1160
4 Ga0070680_100000077 3300005336 Bacteria 53035
5 Ga0068868_100007544 3300005338 Bacteria 7747
6 Ga0070668_100101775 3300005347 Bacteria 2277
7 Ga0070688_100040308 3300005365 Bacteria 2862
8 Ga0070714_100056497 3300005435 Bacteria 3357
9 Ga0070714_100110068 3300005435 Bacteria 2438
10 Ga0070710_10012736 3300005437 Bacteria 4186
11 Ga0070711_100041641 3300005439 Bacteria 3103
12 Ga0070711_100124393 3300005439 Bacteria 1912
13 Ga0070678_100058380 3300005456 Bacteria 2831
14 Ga0070681_10000039 3300005458 Bacteria 92866
15 Ga0070706_100381378 3300005467 Bacteria 1313
16 Ga0070698_100009052 3300005471 Bacteria 10704
17 Ga0070679_100000146 3300005530 Bacteria 57305
18 Ga0070684_100029117 3300005535 Bacteria 4677
19 Ga0070696_100279690 3300005546 Bacteria 1272
20 Ga0070665_100016738 3300005548 Bacteria 7347
21 Ga0070665_100043303 3300005548 Bacteria 4524
22 Ga0068864_100438205 3300005618 Bacteria 1248
23 Ga0068866_10096913 3300005718 Bacteria 1619
24 Ga0068861_100112570 3300005719 Bacteria 2182
25 Ga0075365_10030836 3300006038 Bacteria 3438
26 Ga0075365_10198359 3300006038 Bacteria 1406
27 Ga0075363_100041935 3300006048 Bacteria 2415
28 Ga0075363_100167015 3300006048 Bacteria 1248
29 Ga0075364_10019329 3300006051 Bacteria 4275
30 Ga0075370_10014307 3300006353 Bacteria 4231
31 Ga0075428_100060645 3300006844 Bacteria 4142
32 Ga0075428_100138529 3300006844 Bacteria 2646
33 Ga0075431_100088265 3300006847 Bacteria 3200
34 Ga0075429_100139695 3300006880 Bacteria 2120
35 Ga0075429_100425620 3300006880 Bacteria 1163
36 Ga0105245_10100111 3300009098 Bacteria 2681
37 Ga0105245_10279504 3300009098 Bacteria 1631
38 Ga0114129_10533617 3300009147 Bacteria 1528
39 Ga0105243_10087729 3300009148 Bacteria 2554
40 Ga0157369_10105671 3300013105 Bacteria 2997
41 Ga0163162_10011973 3300013306 Bacteria 8459
42 Ga0157375_10174406 3300013308 Bacteria 2299
43 Ga0157376_10244491 3300014969 Bacteria 1673
44 Ga0213873_10004744 3300021358 Bacteria 2561
45 Ga0213876_10002776 3300021384 Bacteria 10205
46 Ga0207692_10065589 3300025898 Bacteria 1895
47 Ga0207642_10135210 3300025899 Bacteria 1292
48 Ga0207688_10001081 3300025901 Bacteria 13962
49 Ga0207647_10058112 3300025904 Bacteria 2369
50 Ga0207647_10099333 3300025904 Bacteria 1729
51 Ga0207684_10286681 3300025910 Bacteria 1420
52 Ga0207707_10000313 3300025912 Bacteria 51103
53 Ga0207660_10000126 3300025917 Bacteria 45218
54 Ga0207652_10000277 3300025921 Bacteria 53168
55 Ga0207687_10124399 3300025927 Bacteria 1933
56 Ga0207706_10159268 3300025933 Bacteria 1985
57 Ga0207691_10051181 3300025940 Bacteria 3777
58 Ga0207640_10213719 3300025981 Bacteria 1471
59 Ga0207677_10010921 3300026023 Bacteria 5158
60 Ga0207678_10057159 3300026067 Bacteria 3357
61 Ga0207708_10084448 3300026075 Bacteria 2441
62 Ga0207675_100456851 3300026118 Bacteria 1266
63 Ga0207683_10050812 3300026121 Bacteria 3632
64 Ga0268266_10099725 3300028379 Bacteria 2557
65 Ga0307515_10003658 3300028794 Bacteria 32307
66 Ga0307512_10019685 3300030522 Bacteria 6137
67 Ga0265339_10053075 3300031249 Bacteria 2205
68 Ga0307513_10010212 3300031456 Bacteria 11797
69 Ga0307516_10019325 3300031730 Bacteria 7056
70 Ga0307516_10058066 3300031730 Bacteria 3768
71 Ga0307516_10350023 3300031730 Bacteria 1143
72 Ga0307416_100131663 3300032002 Bacteria 2253
73 Ga0373942_0000809 3300035207 Bacteria 8617
74 Ga0373931_0043082 3300035691 Bacteria 2375
75 Ga0436364_1059460 3300037853 Bacteria 4481
76 Ga0436365_0694005 3300039437 Bacteria 12947
77 Ga0436362_1261471 3300039453 Bacteria 3830
78 Ga0439465_0020895 3300041413 Bacteria 2052
79 Ga0450903_002535 3300042138 Bacteria 3240
80 Ga0466969_0045125 3300044656 Bacteria 2189
81 Ga0466972_0026171 3300044658 Bacteria 2890
82 Ga0466966_0012148 3300044684 Bacteria 5705
83 Ga0466966_0094797 3300044684 Bacteria 1850
84 Ga0466961_0002670 3300044693 Bacteria 11065
85 Ga0466963_0012839 3300044694 Bacteria 5132
86 Ga0466964_0049924 3300044706 Bacteria 1714
87 Ga0466971_0034888 3300044719 Bacteria 2255
88 Ga0466971_0056441 3300044719 Bacteria 1771
89 Ga0466968_0002047 3300044735 Bacteria 7335
90 Ga0466968_0015685 3300044735 Bacteria 3007
91 Ga0466957_0002976 3300044842 Bacteria 9200
92 Ga0466957_0028454 3300044842 Bacteria 3328
93 Ga0466957_0090464 3300044842 Bacteria 1917
94 Ga0466957_0155450 3300044842 Bacteria 1482
95 Ga0466959_0027932 3300045049 Bacteria 4184
96 Ga0466958_0006950 3300045836 Bacteria 6192
97 Ga0466958_0015384 3300045836 Bacteria 4385
98 Ga0466967_0067001 3300045976 Bacteria 3201
99 Ga0466967_0153766 3300045976 Bacteria 2153
100 Ga0466967_0262614 3300045976 Bacteria 1652
101 Ga0495630_0131760 3300046517 Bacteria 1899
102 Ga0495632_0058277 3300046519 Bacteria 1883
103 Ga0495648_0024211 3300046524 Bacteria 4141
104 Ga0495669_0030465 3300046684 Bacteria 2368
105 Ga0495684_0220749 3300047471 Bacteria 1390
106 Ga0495593_0022036 3300047673 Bacteria 3555
107 Ga0496105_0035929 3300048908 Bacteria 4081
108 Ga0496108_0000759 3300048911 Bacteria 25117
109 Ga0496108_0204574 3300048911 Bacteria 1713
110 Ga0496109_0002063 3300048912 Bacteria 16675
111 Ga0496110_0010924 3300048913 Bacteria 7406
112 Ga0496112_0144185 3300048915 Bacteria 2350
113 Ga0496115_0080728 3300048918 Bacteria 2648
114 Ga0496125_0206888 3300048928 Bacteria 1279
115 Ga0496126_0000027 3300048929 Bacteria 396518
116 Ga0501032_0004434 3300049569 Bacteria 10581
117 Ga0501033_0022672 3300049570 Bacteria 4736
118 Ga0501034_0003163 3300049571 Bacteria 18924
119 Ga0501037_0016834 3300049573 Bacteria 5379
120 Ga0501043_0015843 3300049579 Bacteria 5908
121 Ga0501046_0001136 3300049580 Bacteria 25942
122 Ga0501047_0008199 3300049581 Bacteria 9869
123 Ga0501047_0375421 3300049581 Bacteria 1257
124 Ga0501048_0001774 3300049582 Bacteria 16425
125 Ga0501069_0015962 3300049585 Bacteria 4028
126 Ga0501070_0000622 3300049586 Bacteria 32559
127 Ga0501070_0068563 3300049586 Bacteria 2936
128 Ga0501071_0355550 3300049587 Bacteria 1115
129 Ga0501073_0011051 3300049589 Bacteria 6604
130 Ga0501073_0104127 3300049589 Bacteria 1970
131 Ga0501079_0040035 3300049741 Bacteria 3615
132 Ga0501080_0001256 3300049742 Bacteria 21114
133 Ga0501080_0012680 3300049742 Bacteria 7730
134 Ga0501080_0118855 3300049742 Bacteria 2450
135 Ga0501035_0017267 3300049822 Bacteria 6653
136 Ga0501044_0001366 3300049823 Bacteria 28620
137 Ga0501044_0006727 3300049823 Bacteria 12678
138 Ga0501044_0440474 3300049823 Bacteria 1211
139 nmdc:mga00v17_11764_c1 3300050491 Bacteria 4812
140 nmdc:mga00v17_50787_c1 3300050491 Bacteria 2521
141 nmdc:mga0yw44_31000_c1 3300050492 Bacteria 2057
142 nmdc:mga06z11_71997_c1 3300050494 Bacteria 1831
143 nmdc:mga07m45_15287_c1 3300050496 Bacteria 4097
144 nmdc:mga09592_246141_c1 3300050508 Bacteria 1549
145 nmdc:mga06r32_28247_c1 3300050510 Bacteria 5246
146 nmdc:mga08y16_122531_c1 3300050511 Bacteria 2705
147 nmdc:mga0sz30_51244_c1 3300050516 Bacteria 1750
148 Ga0495601_0103718 3300053077 Bacteria 1838
149 Ga0495619_0048620 3300053085 Bacteria 2795
150 Ga0495619_0060887 3300053085 Bacteria 2510
151 Ga0500643_002800 3300053087 Bacteria 8719
152 Ga0500641_0029647 3300053096 Bacteria 2145
153 Ga0466962_0001728 3300061719 Bacteria 10266
154 Ga0466962_0027924 3300061719 Bacteria 2705
155 Ga0530510_0011823 3300061734 Bacteria 6125
156 2523382994 2523231044 Bacteria 6434991
157 2585313813 2582581314 Bacteria 11452267
158 2671836169 2671180195 Bacteria 9757215
159 2686539989 2684623035 Bacteria 8032739
160 2689994281 2687453743 Bacteria 8361025
161 2744955271 2744054611 Bacteria 5611514
162 2774854325 2773857922 Bacteria 9757215
163 2792838421 2791355137 Bacteria 9654227
164 2812361067 2811994879 Bacteria 9313447
165 2842140190 2842134933 Bacteria 5847019
166 2895888806 2895880812 Bacteria 11255272
167 2904622304 2904615490 Bacteria 10047340
168 Ga0501069_0012290
169 JGI24746J21847_1004471
170 JGI24744J21845_10025205
171 Ga0070680_100000077
172 Ga0068868_100007544
173 Ga0070668_100101775
174 Ga0070688_100040308
175 Ga0070714_100056497
176 Ga0070714_100110068
177 Ga0070710_10012736
178 Ga0070711_100041641
179 Ga0070711_100124393
180 Ga0070678_100058380
181 Ga0070681_10000039
182 Ga0070706_100381378
183 Ga0070698_100009052
184 Ga0070679_100000146
185 Ga0070684_100029117
186 Ga0070696_100279690
187 Ga0070665_100016738
188 Ga0070665_100043303
189 Ga0068864_100438205
190 Ga0068866_10096913
191 Ga0068861_100112570
192 Ga0075365_10030836
193 Ga0075365_10198359
194 Ga0075363_100041935
195 Ga0075363_100167015
196 Ga0075364_10019329
197 Ga0075370_10014307
198 Ga0075428_100060645
199 Ga0075428_100138529
200 Ga0075431_100088265
201 Ga0075429_100139695
202 Ga0075429_100425620
203 Ga0105245_10100111
204 Ga0105245_10279504
205 Ga0114129_10533617
206 Ga0105243_10087729
207 Ga0157369_10105671
208 Ga0163162_10011973
209 Ga0157375_10174406
210 Ga0157376_10244491
211 Ga0213873_10004744
212 Ga0213876_10002776
213 Ga0207692_10065589
214 Ga0207642_10135210
215 Ga0207688_10001081
216 Ga0207647_10058112
217 Ga0207647_10099333
218 Ga0207684_10286681
219 Ga0207707_10000313
220 Ga0207660_10000126
221 Ga0207652_10000277
222 Ga0207687_10124399
223 Ga0207706_10159268
224 Ga0207691_10051181
225 Ga0207640_10213719
226 Ga0207677_10010921
227 Ga0207678_10057159
228 Ga0207708_10084448
229 Ga0207675_100456851
230 Ga0207683_10050812
231 Ga0268266_10099725
232 Ga0307515_10003658
233 Ga0307512_10019685
234 Ga0265339_10053075
235 Ga0307513_10010212
236 Ga0307516_10019325
237 Ga0307516_10058066
238 Ga0307516_10350023
239 Ga0307416_100131663
240 Ga0373942_0000809
241 Ga0373931_0043082
242 Ga0436364_1059460
243 Ga0436365_0694005
244 Ga0436362_1261471
245 Ga0439465_0020895
246 Ga0450903_002535
247 Ga0466969_0045125
248 Ga0466972_0026171
249 Ga0466966_0012148
250 Ga0466966_0094797
251 Ga0466961_0002670
252 Ga0466963_0012839
253 Ga0466964_0049924
254 Ga0466971_0034888
255 Ga0466971_0056441
256 Ga0466968_0002047
257 Ga0466968_0015685
258 Ga0466957_0002976
259 Ga0466957_0028454
260 Ga0466957_0090464
261 Ga0466957_0155450
262 Ga0466959_0027932
263 Ga0466958_0006950
264 Ga0466958_0015384
265 Ga0466967_0067001
266 Ga0466967_0153766
267 Ga0466967_0262614
268 Ga0495630_0131760
269 Ga0495632_0058277
270 Ga0495648_0024211
271 Ga0495669_0030465
272 Ga0495684_0220749
273 Ga0495593_0022036
274 Ga0496105_0035929
275 Ga0496108_0000759
276 Ga0496108_0204574
277 Ga0496109_0002063
278 Ga0496110_0010924
279 Ga0496112_0144185
280 Ga0496115_0080728
281 Ga0496125_0206888
282 Ga0496126_0000027
283 Ga0501032_0004434
284 Ga0501033_0022672
285 Ga0501034_0003163
286 Ga0501037_0016834
287 Ga0501043_0015843
288 Ga0501046_0001136
289 Ga0501047_0008199
290 Ga0501047_0375421
291 Ga0501048_0001774
292 Ga0501069_0015962
293 Ga0501070_0000622
294 Ga0501070_0068563
295 Ga0501071_0355550
296 Ga0501073_0011051
297 Ga0501073_0104127
298 Ga0501079_0040035
299 Ga0501080_0001256
300 Ga0501080_0012680
301 Ga0501080_0118855
302 Ga0501035_0017267
303 Ga0501044_0001366
304 Ga0501044_0006727
305 Ga0501044_0440474
306 nmdc:mga00v17_11764_c1
307 nmdc:mga00v17_50787_c1
308 nmdc:mga0yw44_31000_c1
309 nmdc:mga06z11_71997_c1
310 nmdc:mga07m45_15287_c1
311 nmdc:mga09592_246141_c1
312 nmdc:mga06r32_28247_c1
313 nmdc:mga08y16_122531_c1
314 nmdc:mga0sz30_51244_c1
315 Ga0495601_0103718
316 Ga0495619_0048620
317 Ga0495619_0060887
318 Ga0500643_002800
319 Ga0500641_0029647
320 Ga0466962_0001728
321 Ga0466962_0027924
322 Ga0530510_0011823
323 2523382994
324 2585313813
325 2671836169
326 2686539989
327 2689994281
328 2744955271
329 2774854325
330 2792838421
331 2812361067
332 2842140190
333 2895888806
334 2904622304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

7

367

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.8767 8 37
5y7a-assembly1.cif.gz_A crystal structure of pseudomonas fluorescens kynurenine 3-monooxygenase in complex with l-kyn 0.8664 7 37
6foz-assembly2.cif.gz_B the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 13 0.8649 7 37
5nak-assembly1.cif.gz_B pseudomonas fluorescens kynurenine 3-monooxygenase (kmo) in complex with the enzyme substrate l-kynurenine 0.8646 7 37
5x6p-assembly2.cif.gz_B crystal structure of pseudomonas fluorescens kmo 0.8642 7 37
ID Description Score Start End Superfamily
4ed9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9359 1 210 3.40.50.10540
4hl6D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9331 3 211 3.40.50.10540
af_O06543_1_217_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9015 1 210 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8894 24 221 3.40.50.10540
af_O06543_1_217_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8699 1 210 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A2A7MQS9-F1-model_v4 CoA transferase 0.9791 1 138 GO:0016740
AF-A0A6J5CU96-F1-model_v4 Formyl-CoA:oxalate CoA-transferase (EC 2.8.3.16) 0.9558 3 142 GO:0033608
AF-A0A2A7MQS9-F1-model_v4 CoA transferase 0.9518 1 138 GO:0016740
AF-A0A7C7GVK2-F1-model_v4 CoA transferase 0.946 3 186 GO:0008410
AF-A0A1Z8R145-F1-model_v4 deleted 0.9416 3 141

Map