F251332

General Info

Members Datasets Scaffolds Average Seq Length
167 99 334 115

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0191271|Ga0501037_0191271_707_1084
Length 111
Sequence MTSANPTPGPAMSGLTVRWSLVDAPAEVAEKLAAYVEDASHARFEVMPGLRFKTWRMRPGEWFEGAEFTAGAAAAPGSMIVGAAPVLIEPCQVVATAAGGAGFVSAPAFDR

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
8 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
17 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
20 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
28 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
31 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
32 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
33 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
34 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
35 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
36 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
37 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
38 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
39 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
40 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
41 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
42 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
43 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
44 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
45 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
53 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
56 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
59 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
60 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
61 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
62 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
63 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
66 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
67 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
70 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
71 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
72 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
73 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
74 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
75 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
76 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
77 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
78 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
79 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
80 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
81 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
82 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
83 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
85 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
86 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
87 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
88 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
89 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
90 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
91 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
92 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
93 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
97 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
98 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
99 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.2
Metatranscriptomes 0.6
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.15
Nodule 0
Rhizoplane 2.4
Rhizosphere 71.26
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0191271 3300049573 Bacteria 1449
2 LJQas_1002074 3300000549 Bacteria 2856
3 Ga0070660_100002936 3300005339 Bacteria 11729
4 Ga0070659_100012759 3300005366 Bacteria 6237
5 Ga0070659_100345779 3300005366 Bacteria 1247
6 Ga0070662_101048556 3300005457 Bacteria 699
7 Ga0070698_100003056 3300005471 Bacteria 18446
8 Ga0070693_100890447 3300005547 Bacteria 666
9 Ga0068861_100876888 3300005719 Bacteria 848
10 Ga0070717_10716626 3300006028 Bacteria 909
11 Ga0075365_10006274 3300006038 Bacteria 6522
12 Ga0075365_10134209 3300006038 Bacteria 1714
13 Ga0075365_10151408 3300006038 Bacteria 1614
14 Ga0075365_10321506 3300006038 Bacteria 1090
15 Ga0075365_10830096 3300006038 Bacteria 652
16 Ga0075365_10958744 3300006038 Bacteria 603
17 Ga0075365_11020847 3300006038 Bacteria 583
18 Ga0075363_100003844 3300006048 Bacteria 6474
19 Ga0075363_100016785 3300006048 Bacteria 3620
20 Ga0075363_100128287 3300006048 Bacteria 1421
21 Ga0075364_10038297 3300006051 Bacteria 3106
22 Ga0075364_10049483 3300006051 Bacteria 2741
23 Ga0075364_10131044 3300006051 Bacteria 1683
24 Ga0075364_10676053 3300006051 Bacteria 705
25 Ga0075362_10014028 3300006177 Bacteria 3224
26 Ga0075367_10138719 3300006178 Bacteria 1505
27 Ga0075367_10518060 3300006178 Bacteria 757
28 Ga0075367_10595013 3300006178 Bacteria 703
29 Ga0075370_10009736 3300006353 Bacteria 5003
30 Ga0075370_10018640 3300006353 Bacteria 3766
31 Ga0075370_10268324 3300006353 Bacteria 1013
32 Ga0105239_10053353 3300010375 Bacteria 4435
33 Ga0157380_12286729 3300014326 Bacteria 605
34 Ga0182008_10551505 3300014497 Bacteria 640
35 Ga0206353_10359540 3300020082 Bacteria 731
36 Ga0207647_10040504 3300025904 Bacteria 2934
37 Ga0207705_10886094 3300025909 Bacteria 691
38 Ga0207657_10005579 3300025919 Bacteria 13139
39 Ga0207657_10295370 3300025919 Bacteria 1284
40 Ga0207690_10627293 3300025932 Bacteria 879
41 Ga0207690_11775002 3300025932 Bacteria 515
42 Ga0207706_11504078 3300025933 Bacteria 549
43 Ga0207661_10172003 3300025944 Bacteria 1886
44 Ga0207675_100974093 3300026118 Bacteria 866
45 Ga0209813_10009800 3300027866 Bacteria 2462
46 Ga0316182_1291909 3300030745 Bacteria 7850
47 Ga0307408_100907309 3300031548 Bacteria 807
48 Ga0307405_10276244 3300031731 Bacteria 1262
49 Ga0307405_11188009 3300031731 Bacteria 659
50 Ga0307413_10417168 3300031824 Bacteria 1056
51 Ga0307413_10517324 3300031824 Bacteria 962
52 Ga0307410_10702398 3300031852 Bacteria 853
53 Ga0307406_10244135 3300031901 Bacteria 1349
54 Ga0307407_10037505 3300031903 Bacteria 2679
55 Ga0307407_10054864 3300031903 Bacteria 2300
56 Ga0307412_10491162 3300031911 Bacteria 1020
57 Ga0307409_100054261 3300031995 Bacteria 3086
58 Ga0307409_101215034 3300031995 Bacteria 777
59 Ga0307409_101924525 3300031995 Bacteria 621
60 Ga0307409_102452310 3300031995 Bacteria 550
61 Ga0307416_100475517 3300032002 Bacteria 1308
62 Ga0307416_101161157 3300032002 Bacteria 877
63 Ga0307411_11551214 3300032005 Bacteria 610
64 Ga0307415_100016895 3300032126 Bacteria 4363
65 Ga0307415_100497035 3300032126 Bacteria 1065
66 Ga0395901_0440785 3300038443 Bacteria 1333
67 Ga0395901_1862589 3300038443 Bacteria 550
68 Ga0395901_1934803 3300038443 Bacteria 537
69 Ga0439466_0102230 3300041411 Bacteria 893
70 Ga0439465_0070035 3300041413 Bacteria 1174
71 Ga0451793_0931172 3300041452 Bacteria 611
72 Ga0451855_1945684 3300041511 Bacteria 634
73 Ga0466972_0051468 3300044658 Bacteria 1987
74 Ga0466965_0046065 3300044683 Bacteria 2158
75 Ga0466965_0069508 3300044683 Bacteria 1769
76 Ga0466966_0046378 3300044684 Bacteria 2775
77 Ga0466961_0061287 3300044693 Bacteria 2391
78 Ga0466961_0272738 3300044693 Bacteria 1036
79 Ga0466961_0318504 3300044693 Bacteria 949
80 Ga0466963_0038356 3300044694 Bacteria 3132
81 Ga0466963_0180568 3300044694 Bacteria 1473
82 Ga0466964_0199676 3300044706 Bacteria 959
83 Ga0466971_0040322 3300044719 Bacteria 2097
84 Ga0466971_0213757 3300044719 Bacteria 912
85 Ga0466970_0015767 3300044765 Bacteria 3890
86 Ga0466970_0209115 3300044765 Bacteria 1087
87 Ga0466970_0425251 3300044765 Bacteria 760
88 Ga0466957_0041362 3300044842 Bacteria 2787
89 Ga0466957_0093359 3300044842 Bacteria 1888
90 Ga0466957_0198021 3300044842 Bacteria 1318
91 Ga0466960_0090755 3300044901 Bacteria 1557
92 Ga0466959_0174200 3300045049 Bacteria 1508
93 Ga0466958_0005675 3300045836 Bacteria 6742
94 Ga0466958_0514921 3300045836 Bacteria 776
95 Ga0466967_0040888 3300045976 Bacteria 3994
96 Ga0466967_0181319 3300045976 Bacteria 1986
97 Ga0466967_0627026 3300045976 Bacteria 1062
98 Ga0495596_0161147 3300046500 Bacteria 872
99 Ga0496105_0478058 3300048908 Bacteria 981
100 Ga0496108_0049712 3300048911 Bacteria 3507
101 Ga0496110_0320045 3300048913 Bacteria 1413
102 Ga0501036_0108095 3300049572 Bacteria 2352
103 Ga0501037_0556753 3300049573 Bacteria 773
104 Ga0501038_0264524 3300049574 Bacteria 1358
105 Ga0501039_0139794 3300049575 Bacteria 1902
106 Ga0501039_0588461 3300049575 Bacteria 872
107 Ga0501040_0296599 3300049576 Bacteria 1155
108 Ga0501040_1183415 3300049576 Bacteria 555
109 Ga0501041_0121960 3300049577 Bacteria 1620
110 Ga0501041_0731145 3300049577 Bacteria 634
111 Ga0501046_0766502 3300049580 Bacteria 677
112 Ga0501048_0065454 3300049582 Bacteria 2570
113 Ga0501048_0609355 3300049582 Bacteria 784
114 Ga0501067_0513166 3300049583 Bacteria 671
115 Ga0501068_0054594 3300049584 Bacteria 2420
116 Ga0501068_0127176 3300049584 Bacteria 1592
117 Ga0501069_0069293 3300049585 Bacteria 1975
118 Ga0501069_0208704 3300049585 Bacteria 1133
119 Ga0501070_0169529 3300049586 Bacteria 1798
120 Ga0501070_0264314 3300049586 Bacteria 1406
121 Ga0501070_1293468 3300049586 Bacteria 557
122 Ga0501071_0753028 3300049587 Bacteria 750
123 Ga0501072_0371250 3300049588 Bacteria 1135
124 Ga0501073_0046646 3300049589 Bacteria 3046
125 Ga0501074_0101386 3300049590 Bacteria 2061
126 Ga0501074_0224635 3300049590 Bacteria 1337
127 Ga0501075_0047608 3300049591 Bacteria 3222
128 Ga0501076_0040626 3300049592 Bacteria 3656
129 Ga0501076_0215385 3300049592 Bacteria 1570
130 Ga0501077_0176675 3300049593 Bacteria 1357
131 Ga0501079_0431029 3300049741 Bacteria 1035
132 Ga0501080_0854995 3300049742 Bacteria 795
133 Ga0501080_0989748 3300049742 Bacteria 730
134 Ga0501081_0466143 3300049743 Bacteria 939
135 Ga0501035_0179301 3300049822 Bacteria 1826
136 Ga0501044_0457723 3300049823 Bacteria 1182
137 Ga0501045_0074272 3300049824 Bacteria 2504
138 nmdc:mga03683_659089_c1 3300050489 Bacteria 516
139 nmdc:mga03n38_29549_c1 3300050490 Bacteria 2296
140 nmdc:mga03n38_344284_c1 3300050490 Bacteria 810
141 nmdc:mga03n38_548457_c1 3300050490 Bacteria 654
142 nmdc:mga00v17_1031498_c1 3300050491 Bacteria 517
143 nmdc:mga00v17_576394_c1 3300050491 Bacteria 727
144 nmdc:mga0yw44_26990_c1 3300050492 Bacteria 3285
145 nmdc:mga0yw44_418285_c1 3300050492 Bacteria 907
146 nmdc:mga0yw44_470878_c1 3300050492 Bacteria 852
147 nmdc:mga0yw44_515513_c1 3300050492 Bacteria 811
148 nmdc:mga0yw44_600818_c1 3300050492 Bacteria 747
149 nmdc:mga0yw44_708157_c1 3300050492 Bacteria 684
150 nmdc:mga0yw44_954542_c1 3300050492 Bacteria 581
151 nmdc:mga06z11_103556_c1 3300050494 Bacteria 1566
152 nmdc:mga06z11_238648_c1 3300050494 Bacteria 1067
153 nmdc:mga06z11_98437_c1 3300050494 Bacteria 1600
154 nmdc:mga07m45_22246_c1 3300050496 Bacteria 3460
155 nmdc:mga07m45_281026_c1 3300050496 Bacteria 968
156 Ga0500644_0001927 3300053088 Bacteria 5324
157 Ga0500568_0161705 3300053139 Bacteria 826
158 Ga0501084_0155027 3300054114 Bacteria 1931
159 Ga0501084_1210098 3300054114 Bacteria 634
160 Ga0501082_0331434 3300060353 Bacteria 1326
161 Ga0501082_1135135 3300060353 Bacteria 683
162 Ga0466962_0001949 3300061719 Bacteria 9731
163 Ga0466962_0244172 3300061719 Bacteria 882
164 Ga0530510_0169722 3300061734 Bacteria 1616
165 Ga0530510_0774192 3300061734 Bacteria 732
166 2837270138 2837268691 Bacteria 7850704
167 2855389043 2855386786 Bacteria 4752232
168 Ga0501037_0191271
169 LJQas_1002074
170 Ga0070660_100002936
171 Ga0070659_100012759
172 Ga0070659_100345779
173 Ga0070662_101048556
174 Ga0070698_100003056
175 Ga0070693_100890447
176 Ga0068861_100876888
177 Ga0070717_10716626
178 Ga0075365_10006274
179 Ga0075365_10134209
180 Ga0075365_10151408
181 Ga0075365_10321506
182 Ga0075365_10830096
183 Ga0075365_10958744
184 Ga0075365_11020847
185 Ga0075363_100003844
186 Ga0075363_100016785
187 Ga0075363_100128287
188 Ga0075364_10038297
189 Ga0075364_10049483
190 Ga0075364_10131044
191 Ga0075364_10676053
192 Ga0075362_10014028
193 Ga0075367_10138719
194 Ga0075367_10518060
195 Ga0075367_10595013
196 Ga0075370_10009736
197 Ga0075370_10018640
198 Ga0075370_10268324
199 Ga0105239_10053353
200 Ga0157380_12286729
201 Ga0182008_10551505
202 Ga0206353_10359540
203 Ga0207647_10040504
204 Ga0207705_10886094
205 Ga0207657_10005579
206 Ga0207657_10295370
207 Ga0207690_10627293
208 Ga0207690_11775002
209 Ga0207706_11504078
210 Ga0207661_10172003
211 Ga0207675_100974093
212 Ga0209813_10009800
213 Ga0316182_1291909
214 Ga0307408_100907309
215 Ga0307405_10276244
216 Ga0307405_11188009
217 Ga0307413_10417168
218 Ga0307413_10517324
219 Ga0307410_10702398
220 Ga0307406_10244135
221 Ga0307407_10037505
222 Ga0307407_10054864
223 Ga0307412_10491162
224 Ga0307409_100054261
225 Ga0307409_101215034
226 Ga0307409_101924525
227 Ga0307409_102452310
228 Ga0307416_100475517
229 Ga0307416_101161157
230 Ga0307411_11551214
231 Ga0307415_100016895
232 Ga0307415_100497035
233 Ga0395901_0440785
234 Ga0395901_1862589
235 Ga0395901_1934803
236 Ga0439466_0102230
237 Ga0439465_0070035
238 Ga0451793_0931172
239 Ga0451855_1945684
240 Ga0466972_0051468
241 Ga0466965_0046065
242 Ga0466965_0069508
243 Ga0466966_0046378
244 Ga0466961_0061287
245 Ga0466961_0272738
246 Ga0466961_0318504
247 Ga0466963_0038356
248 Ga0466963_0180568
249 Ga0466964_0199676
250 Ga0466971_0040322
251 Ga0466971_0213757
252 Ga0466970_0015767
253 Ga0466970_0209115
254 Ga0466970_0425251
255 Ga0466957_0041362
256 Ga0466957_0093359
257 Ga0466957_0198021
258 Ga0466960_0090755
259 Ga0466959_0174200
260 Ga0466958_0005675
261 Ga0466958_0514921
262 Ga0466967_0040888
263 Ga0466967_0181319
264 Ga0466967_0627026
265 Ga0495596_0161147
266 Ga0496105_0478058
267 Ga0496108_0049712
268 Ga0496110_0320045
269 Ga0501036_0108095
270 Ga0501037_0556753
271 Ga0501038_0264524
272 Ga0501039_0139794
273 Ga0501039_0588461
274 Ga0501040_0296599
275 Ga0501040_1183415
276 Ga0501041_0121960
277 Ga0501041_0731145
278 Ga0501046_0766502
279 Ga0501048_0065454
280 Ga0501048_0609355
281 Ga0501067_0513166
282 Ga0501068_0054594
283 Ga0501068_0127176
284 Ga0501069_0069293
285 Ga0501069_0208704
286 Ga0501070_0169529
287 Ga0501070_0264314
288 Ga0501070_1293468
289 Ga0501071_0753028
290 Ga0501072_0371250
291 Ga0501073_0046646
292 Ga0501074_0101386
293 Ga0501074_0224635
294 Ga0501075_0047608
295 Ga0501076_0040626
296 Ga0501076_0215385
297 Ga0501077_0176675
298 Ga0501079_0431029
299 Ga0501080_0854995
300 Ga0501080_0989748
301 Ga0501081_0466143
302 Ga0501035_0179301
303 Ga0501044_0457723
304 Ga0501045_0074272
305 nmdc:mga03683_659089_c1
306 nmdc:mga03n38_29549_c1
307 nmdc:mga03n38_344284_c1
308 nmdc:mga03n38_548457_c1
309 nmdc:mga00v17_1031498_c1
310 nmdc:mga00v17_576394_c1
311 nmdc:mga0yw44_26990_c1
312 nmdc:mga0yw44_418285_c1
313 nmdc:mga0yw44_470878_c1
314 nmdc:mga0yw44_515513_c1
315 nmdc:mga0yw44_600818_c1
316 nmdc:mga0yw44_708157_c1
317 nmdc:mga0yw44_954542_c1
318 nmdc:mga06z11_103556_c1
319 nmdc:mga06z11_238648_c1
320 nmdc:mga06z11_98437_c1
321 nmdc:mga07m45_22246_c1
322 nmdc:mga07m45_281026_c1
323 Ga0500644_0001927
324 Ga0500568_0161705
325 Ga0501084_0155027
326 Ga0501084_1210098
327 Ga0501082_0331434
328 Ga0501082_1135135
329 Ga0466962_0001949
330 Ga0466962_0244172
331 Ga0530510_0169722
332 Ga0530510_0774192
333 2837270138
334 2855389043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jil-assembly1.cif.gz_F 70s ribosome flavobacterium johnsoniae 0.7485 36 71
3tvz-assembly1.cif.gz_A structure of bacillus subtilis hmob 0.729 3 70
4fvc-assembly4.cif.gz_D hmob structure with heme 0.7047 3 69
1wd6-assembly1.cif.gz_B crystal structure of jw1657 from escherichia coli 0.7003 3 97
6fxd-assembly1.cif.gz_B-2 crystal structure of mupz from pseudomonas fluorescens 0.6987 3 77
ID Description Score Start End Superfamily
af_P9WLA3_28_227_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7773 3 92 3.30.70.100
af_Q6NQZ5_5_128_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7578 44 74 2.30.29.30
2pd1D01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7219 3 92 3.30.70.100
af_K7L852_202_290_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7031 2 94 3.30.70.330
af_Q8IMX4_1_85_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.7008 2 71 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A7Y0DCX0-F1-model_v4 Uncharacterized protein 1.001 3 88
AF-A0A7Y0CXY3-F1-model_v4 Monooxygenase 0.9882 3 107
AF-A0A3N0CHX0-F1-model_v4 Uncharacterized protein 0.9832 3 108
AF-A0A401Y8P1-F1-model_v4 Monooxygenase 0.9807 1 112
AF-E2SDN9-F1-model_v4 ABM domain-containing protein 0.9791 1 110

Map