F250964

General Info

Members Datasets Scaffolds Average Seq Length
167 92 334 257

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1390587|Ga0436365_1390587_2612_3454
Length 280
Sequence MPELPDVEGFRRYLARHAAGHRIVRVEVPDRELIRNSSASALSRAIIGQRFAHPLRHGKWLIAPVGELELLLHFGMTGFLRWSSARDRAHGDSSHRQPRDPRGKPRDPYDRVIFDCDDGELRYNNMRRFGGIWLARDARERAAVTGPLGPDAAALERRTFNELLSKRRGSIKAALMDQRLIAGIGNLLSDEILWRARVHPATPVASLGPNRRGRLFEALDATVSESIRYGRVPHGERWLTRVRDDRGAICPRCGARLRWATIAGRTACWCPRDQPSRGGR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
15 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
19 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
22 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
23 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
24 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
25 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
26 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
27 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
28 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
29 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
30 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
31 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
40 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
41 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
42 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
43 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
44 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
45 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
46 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
47 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
48 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
49 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
50 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
51 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
52 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
53 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
54 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
55 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
57 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
58 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
59 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
60 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
62 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
63 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
64 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
65 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
66 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
67 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
68 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
69 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
70 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
77 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
78 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
81 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
82 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
83 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
84 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
85 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
86 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
87 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
88 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
89 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
90 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
91 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
92 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 0
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.99
Nodule 0
Rhizoplane 2.99
Rhizosphere 86.83
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1390587 3300039437 Bacteria 3664
2 JGI25407J50210_10001847 3300003373 Bacteria 4899
3 JGI25407J50210_10015175 3300003373 Bacteria 1987
4 JGI25405J52794_10010873 3300003911 Bacteria 1737
5 Ga0070688_100135028 3300005365 Bacteria 1669
6 Ga0070714_100362136 3300005435 Bacteria 1364
7 Ga0070713_100074605 3300005436 Bacteria 2874
8 Ga0070713_100638947 3300005436 Bacteria 1013
9 Ga0070713_100700017 3300005436 Bacteria 967
10 Ga0070698_100002382 3300005471 Bacteria 20736
11 Ga0081455_10000025 3300005937 Bacteria 157583
12 Ga0081538_10000096 3300005981 Bacteria 85350
13 Ga0081538_10000150 3300005981 Bacteria 72682
14 Ga0081538_10000163 3300005981 Bacteria 70652
15 Ga0081538_10000473 3300005981 Bacteria 45178
16 Ga0081538_10000611 3300005981 Bacteria 39605
17 Ga0081538_10000623 3300005981 Bacteria 39341
18 Ga0081538_10014032 3300005981 Bacteria 6300
19 Ga0081538_10014975 3300005981 Bacteria 6034
20 Ga0081538_10034301 3300005981 Bacteria 3356
21 Ga0081538_10059749 3300005981 Bacteria 2199
22 Ga0081538_10073732 3300005981 Unclassified 1863
23 Ga0081538_10136497 3300005981 Bacteria 1141
24 Ga0070717_10051946 3300006028 Bacteria 3375
25 Ga0075365_10015138 3300006038 Bacteria 4658
26 Ga0075363_100007759 3300006048 Bacteria 4957
27 Ga0075364_10016273 3300006051 Bacteria 4625
28 Ga0075432_10133335 3300006058 Bacteria 942
29 Ga0075369_10036412 3300006186 Bacteria 2094
30 Ga0075370_10006175 3300006353 Bacteria 6009
31 Ga0111539_10251230 3300009094 Bacteria 2059
32 Ga0213875_10076147 3300021388 Bacteria 1566
33 Ga0207664_10337732 3300025929 Bacteria 1331
34 Ga0207678_10226168 3300026067 Bacteria 1602
35 Ga0207428_10196382 3300027907 Bacteria 1519
36 Ga0307408_100022102 3300031548 Bacteria 4317
37 Ga0307405_10026065 3300031731 Bacteria 3367
38 Ga0307413_10390272 3300031824 Bacteria 1087
39 Ga0307410_10604214 3300031852 Bacteria 915
40 Ga0307406_10179580 3300031901 Bacteria 1540
41 Ga0307409_100003466 3300031995 Bacteria 8569
42 Ga0307409_100065796 3300031995 Bacteria 2854
43 Ga0307414_10135587 3300032004 Bacteria 1919
44 Ga0307411_10754856 3300032005 Bacteria 852
45 Ga0307415_100090082 3300032126 Bacteria 2217
46 Ga0436364_0478526 3300037853 Bacteria 2809
47 Ga0395901_0335782 3300038443 Unclassified 1562
48 Ga0436365_0900132 3300039437 Bacteria 3825
49 Ga0436365_1863936 3300039437 Bacteria 9205
50 Ga0466969_0015625 3300044656 Bacteria 3977
51 Ga0466969_0111472 3300044656 Bacteria 1280
52 Ga0466965_0041128 3300044683 Bacteria 2277
53 Ga0466966_0002282 3300044684 Bacteria 12495
54 Ga0466961_0005205 3300044693 Bacteria 8186
55 Ga0466961_0013588 3300044693 Bacteria 5214
56 Ga0466961_0137414 3300044693 Unclassified 1531
57 Ga0466961_0142818 3300044693 Bacteria 1498
58 Ga0466963_0000929 3300044694 Bacteria 14955
59 Ga0466963_0094059 3300044694 Bacteria 2044
60 Ga0466963_0317960 3300044694 Unclassified 1095
61 Ga0466964_0028341 3300044706 Bacteria 2206
62 Ga0466971_0080857 3300044719 Bacteria 1482
63 Ga0466971_0162253 3300044719 Bacteria 1046
64 Ga0466968_0003861 3300044735 Bacteria 5564
65 Ga0466968_0026447 3300044735 Bacteria 2382
66 Ga0466968_0196316 3300044735 Bacteria 944
67 Ga0466970_0036240 3300044765 Bacteria 2613
68 Ga0466957_0029138 3300044842 Bacteria 3290
69 Ga0466957_0151463 3300044842 Bacteria 1500
70 Ga0466960_0000435 3300044901 Bacteria 14256
71 Ga0466960_0107207 3300044901 Bacteria 1446
72 Ga0466959_0003931 3300045049 Bacteria 9866
73 Ga0466959_0051307 3300045049 Bacteria 3026
74 Ga0466959_0205647 3300045049 Bacteria 1369
75 Ga0466958_0003834 3300045836 Bacteria 7855
76 Ga0466958_0015447 3300045836 Bacteria 4375
77 Ga0466967_0005604 3300045976 Bacteria 8732
78 Ga0466967_0012100 3300045976 Bacteria 6581
79 Ga0466967_0053347 3300045976 Bacteria 3553
80 Ga0466967_0174071 3300045976 Bacteria 2027
81 Ga0466967_0414710 3300045976 Bacteria 1312
82 Ga0466967_0460565 3300045976 Bacteria 1244
83 Ga0466967_0505939 3300045976 Unclassified 1186
84 Ga0495613_0012805 3300046689 Bacteria 6236
85 Ga0496104_0066173 3300048907 Bacteria 3431
86 Ga0496105_0058889 3300048908 Bacteria 3170
87 Ga0496109_0710328 3300048912 Bacteria 943
88 Ga0496110_0680884 3300048913 Unclassified 929
89 Ga0496114_0139628 3300048917 Bacteria 2097
90 Ga0501032_0002803 3300049569 Bacteria 13555
91 Ga0501032_0025444 3300049569 Bacteria 4080
92 Ga0501034_0005239 3300049571 Bacteria 14227
93 Ga0501034_0005700 3300049571 Bacteria 13537
94 Ga0501034_0017084 3300049571 Bacteria 7441
95 Ga0501034_0307253 3300049571 Bacteria 1521
96 Ga0501036_0009105 3300049572 Bacteria 8166
97 Ga0501036_0021396 3300049572 Bacteria 5437
98 Ga0501036_0042068 3300049572 Bacteria 3867
99 Ga0501036_0175498 3300049572 Bacteria 1804
100 Ga0501036_0316581 3300049572 Bacteria 1304
101 Ga0501038_0006284 3300049574 Bacteria 10982
102 Ga0501038_0082714 3300049574 Bacteria 2703
103 Ga0501038_0106685 3300049574 Bacteria 2324
104 Ga0501038_0123706 3300049574 Bacteria 2130
105 Ga0501039_0080472 3300049575 Bacteria 2535
106 Ga0501039_0205827 3300049575 Unclassified 1547
107 Ga0501040_0060328 3300049576 Bacteria 2606
108 Ga0501040_0250787 3300049576 Bacteria 1262
109 Ga0501041_0013784 3300049577 Bacteria 4793
110 Ga0501041_0038958 3300049577 Bacteria 2883
111 Ga0501042_0002198 3300049578 Bacteria 11896
112 Ga0501042_0018627 3300049578 Bacteria 4810
113 Ga0501042_0064350 3300049578 Bacteria 2620
114 Ga0501043_0003929 3300049579 Bacteria 12191
115 Ga0501043_0066161 3300049579 Bacteria 2838
116 Ga0501046_0034680 3300049580 Bacteria 4070
117 Ga0501046_0105940 3300049580 Bacteria 2152
118 Ga0501047_0008377 3300049581 Bacteria 9760
119 Ga0501047_0013619 3300049581 Bacteria 7715
120 Ga0501047_0014767 3300049581 Bacteria 7432
121 Ga0501047_0041323 3300049581 Bacteria 4456
122 Ga0501047_0079989 3300049581 Bacteria 3142
123 Ga0501048_0027898 3300049582 Bacteria 4100
124 Ga0501048_0032140 3300049582 Bacteria 3794
125 Ga0501067_0022824 3300049583 Bacteria 3464
126 Ga0501068_0003349 3300049584 Bacteria 8601
127 Ga0501068_0209905 3300049584 Bacteria 1236
128 Ga0501069_0039097 3300049585 Bacteria 2620
129 Ga0501070_0007435 3300049586 Bacteria 9302
130 Ga0501071_0064819 3300049587 Bacteria 2651
131 Ga0501072_0007781 3300049588 Bacteria 8140
132 Ga0501072_0220274 3300049588 Bacteria 1512
133 Ga0501073_0008253 3300049589 Bacteria 7725
134 Ga0501073_0076630 3300049589 Bacteria 2326
135 Ga0501074_0004668 3300049590 Bacteria 9815
136 Ga0501074_0050957 3300049590 Bacteria 2987
137 Ga0501075_0013300 3300049591 Bacteria 5871
138 Ga0501076_0053355 3300049592 Bacteria 3204
139 Ga0501076_0158310 3300049592 Bacteria 1844
140 Ga0501079_0032356 3300049741 Bacteria 4020
141 Ga0501079_0061912 3300049741 Bacteria 2886
142 Ga0501081_0036511 3300049743 Bacteria 3351
143 Ga0501083_0035890 3300049744 Bacteria 3385
144 Ga0501035_0002967 3300049822 Bacteria 16317
145 Ga0501035_0006604 3300049822 Bacteria 10857
146 Ga0501044_0019504 3300049823 Bacteria 7251
147 Ga0501044_0034326 3300049823 Bacteria 5320
148 Ga0501044_0052967 3300049823 Bacteria 4177
149 Ga0501044_0158730 3300049823 Bacteria 2240
150 Ga0501044_0240085 3300049823 Bacteria 1756
151 Ga0501044_0344126 3300049823 Bacteria 1412
152 Ga0501045_0015050 3300049824 Bacteria 5490
153 Ga0501045_0049127 3300049824 Bacteria 3075
154 nmdc:mga03n38_10597_c1 3300050490 Bacteria 3400
155 nmdc:mga00v17_19132_c1 3300050491 Bacteria 3904
156 nmdc:mga0yw44_16738_c1 3300050492 Bacteria 3970
157 nmdc:mga07m45_10400_c1 3300050496 Bacteria 4859
158 nmdc:mga08y16_209975_c1 3300050511 Bacteria 2016
159 nmdc:mga0sz30_9083_c1 3300050516 Bacteria 3769
160 Ga0501084_0048544 3300054114 Bacteria 3553
161 Ga0501084_0687490 3300054114 Bacteria 863
162 Ga0501082_0004088 3300060353 Bacteria 12734
163 Ga0501082_0068250 3300060353 Bacteria 3062
164 Ga0466962_0017579 3300061719 Bacteria 3443
165 Ga0530510_0062944 3300061734 Bacteria 2686
166 2884700967 2884693830 Bacteria 11273186
167 2895452315 2895442618 Bacteria 11027144
168 Ga0436365_1390587
169 JGI25407J50210_10001847
170 JGI25407J50210_10015175
171 JGI25405J52794_10010873
172 Ga0070688_100135028
173 Ga0070714_100362136
174 Ga0070713_100074605
175 Ga0070713_100638947
176 Ga0070713_100700017
177 Ga0070698_100002382
178 Ga0081455_10000025
179 Ga0081538_10000096
180 Ga0081538_10000150
181 Ga0081538_10000163
182 Ga0081538_10000473
183 Ga0081538_10000611
184 Ga0081538_10000623
185 Ga0081538_10014032
186 Ga0081538_10014975
187 Ga0081538_10034301
188 Ga0081538_10059749
189 Ga0081538_10073732
190 Ga0081538_10136497
191 Ga0070717_10051946
192 Ga0075365_10015138
193 Ga0075363_100007759
194 Ga0075364_10016273
195 Ga0075432_10133335
196 Ga0075369_10036412
197 Ga0075370_10006175
198 Ga0111539_10251230
199 Ga0213875_10076147
200 Ga0207664_10337732
201 Ga0207678_10226168
202 Ga0207428_10196382
203 Ga0307408_100022102
204 Ga0307405_10026065
205 Ga0307413_10390272
206 Ga0307410_10604214
207 Ga0307406_10179580
208 Ga0307409_100003466
209 Ga0307409_100065796
210 Ga0307414_10135587
211 Ga0307411_10754856
212 Ga0307415_100090082
213 Ga0436364_0478526
214 Ga0395901_0335782
215 Ga0436365_0900132
216 Ga0436365_1863936
217 Ga0466969_0015625
218 Ga0466969_0111472
219 Ga0466965_0041128
220 Ga0466966_0002282
221 Ga0466961_0005205
222 Ga0466961_0013588
223 Ga0466961_0137414
224 Ga0466961_0142818
225 Ga0466963_0000929
226 Ga0466963_0094059
227 Ga0466963_0317960
228 Ga0466964_0028341
229 Ga0466971_0080857
230 Ga0466971_0162253
231 Ga0466968_0003861
232 Ga0466968_0026447
233 Ga0466968_0196316
234 Ga0466970_0036240
235 Ga0466957_0029138
236 Ga0466957_0151463
237 Ga0466960_0000435
238 Ga0466960_0107207
239 Ga0466959_0003931
240 Ga0466959_0051307
241 Ga0466959_0205647
242 Ga0466958_0003834
243 Ga0466958_0015447
244 Ga0466967_0005604
245 Ga0466967_0012100
246 Ga0466967_0053347
247 Ga0466967_0174071
248 Ga0466967_0414710
249 Ga0466967_0460565
250 Ga0466967_0505939
251 Ga0495613_0012805
252 Ga0496104_0066173
253 Ga0496105_0058889
254 Ga0496109_0710328
255 Ga0496110_0680884
256 Ga0496114_0139628
257 Ga0501032_0002803
258 Ga0501032_0025444
259 Ga0501034_0005239
260 Ga0501034_0005700
261 Ga0501034_0017084
262 Ga0501034_0307253
263 Ga0501036_0009105
264 Ga0501036_0021396
265 Ga0501036_0042068
266 Ga0501036_0175498
267 Ga0501036_0316581
268 Ga0501038_0006284
269 Ga0501038_0082714
270 Ga0501038_0106685
271 Ga0501038_0123706
272 Ga0501039_0080472
273 Ga0501039_0205827
274 Ga0501040_0060328
275 Ga0501040_0250787
276 Ga0501041_0013784
277 Ga0501041_0038958
278 Ga0501042_0002198
279 Ga0501042_0018627
280 Ga0501042_0064350
281 Ga0501043_0003929
282 Ga0501043_0066161
283 Ga0501046_0034680
284 Ga0501046_0105940
285 Ga0501047_0008377
286 Ga0501047_0013619
287 Ga0501047_0014767
288 Ga0501047_0041323
289 Ga0501047_0079989
290 Ga0501048_0027898
291 Ga0501048_0032140
292 Ga0501067_0022824
293 Ga0501068_0003349
294 Ga0501068_0209905
295 Ga0501069_0039097
296 Ga0501070_0007435
297 Ga0501071_0064819
298 Ga0501072_0007781
299 Ga0501072_0220274
300 Ga0501073_0008253
301 Ga0501073_0076630
302 Ga0501074_0004668
303 Ga0501074_0050957
304 Ga0501075_0013300
305 Ga0501076_0053355
306 Ga0501076_0158310
307 Ga0501079_0032356
308 Ga0501079_0061912
309 Ga0501081_0036511
310 Ga0501083_0035890
311 Ga0501035_0002967
312 Ga0501035_0006604
313 Ga0501044_0019504
314 Ga0501044_0034326
315 Ga0501044_0052967
316 Ga0501044_0158730
317 Ga0501044_0240085
318 Ga0501044_0344126
319 Ga0501045_0015050
320 Ga0501045_0049127
321 nmdc:mga03n38_10597_c1
322 nmdc:mga00v17_19132_c1
323 nmdc:mga0yw44_16738_c1
324 nmdc:mga07m45_10400_c1
325 nmdc:mga08y16_209975_c1
326 nmdc:mga0sz30_9083_c1
327 Ga0501084_0048544
328 Ga0501084_0687490
329 Ga0501082_0004088
330 Ga0501082_0068250
331 Ga0466962_0017579
332 Ga0530510_0062944
333 2884700967
334 2895452315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

132

0.91

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

148

234

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5r-assembly1.cif.gz_AM the crystal structure of ef-tu and trp-trna-trp bound to a cognate codon on the 70s ribosome. 0.9229 143 193
4gkk-assembly1.cif.gz_M structure of the thermus thermophilus 30s ribosomal subunit complexed with a human mitochondrial anticodon stem loop (asl) of transfer rna methionine (trnamet) bound to an mrna with an aua-codon in the a-site and paromomycin 0.9139 143 193
1i97-assembly1.cif.gz_M crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline 0.9053 143 193
2uxd-assembly1.cif.gz_M crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna cggg in the context of the thermus thermophilus 30s subunit. 0.9016 143 193
4v7x-assembly1.cif.gz_AM structure of the thermus thermophilus ribosome complexed with erythromycin. 0.8895 145 193
ID Description Score Start End Superfamily
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9258 143 197 1.10.8.50
1fjgM01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.923 145 193 1.10.8.50
2y10M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9229 143 193 1.10.8.50
1xnqM01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9081 143 196 1.10.8.50
3twmA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9004 124 251 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A2V6AS59-F1-model_v4 FPG-type domain-containing protein 0.9399 124 251 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0019104
AF-A0A4R7C2E2-F1-model_v4 deleted 0.9316 1 250
AF-A0A1A1Y776-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9275 1 252 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-A0A1A1Y776-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.924 1 252 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078
AF-D6X6I6-F1-model_v4 Formamidopyrimidine-DNA glycosylase H2TH domain family protein 0.9224 1 195 GO:0003684
GO:0006284
GO:0008270
GO:0034039
GO:0140078

Map