F250902

General Info

Members Datasets Scaffolds Average Seq Length
167 113 334 374

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0034229|Ga0316584_0034229_1651_3000
Length 449
Sequence MVESRVLKGRELERRPGQGTGFGFREISRSNEALRPTLGKEWTEVRSQGRRDPSGTKIACRRDGFSPDFRPDLEAIVMFIGVPKEIHRHEHRVGLTPFAVSQLTAEGHTVFVEKGAGEAAFFTDRDFEDAGAQIVYGREEPYHRSDLVCRVGRPSTEELDLLKPGGVIAAFQHLAVIPRENVDRFLAARSTLIGYEIIQDEFGDFPVLNPFSEMAGQMALPLAAHNLQTEQGGRGILVGNVPGVPPATVLILGAGTVGTVAARSALGVGAHVLVVDDDMNKLRALSRELIGRPVTAICTEERLGRYSAIADVVIGAVLIPGERAPYLVTEEMVRGMKDGSVIIDVSIDQGGCVETSRPTTLDQPTFVSHGVVHYCVPNMTANVPRTASRVLTNVALPYVKSLAKLGVSGAIRADSALARGIYMFRGTMVHERLGDHFGIPATNLNDLLD

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
62 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
63 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
64 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
65 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
66 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
67 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
72 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
73 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
86 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
87 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
88 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
95 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
96 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
97 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
98 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
113 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 1.8
Rhizosphere 93.41
Stem 0
Stem Tuber 0
Unclassified 5.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0034229 3300036712 Bacteria 3766
2 Ga0065707_10092541 3300005295 Bacteria 3750
3 Ga0070683_100336749 3300005329 Bacteria 1437
4 Ga0070690_100001927 3300005330 Bacteria 11022
5 Ga0070690_100056586 3300005330 Unclassified 2515
6 Ga0070670_100019355 3300005331 Bacteria 5841
7 Ga0070666_10006917 3300005335 Bacteria 6990
8 Ga0070687_100000949 3300005343 Bacteria 9841
9 Ga0070671_100024275 3300005355 Bacteria 4963
10 Ga0070673_100008677 3300005364 Bacteria 6775
11 Ga0070673_100064046 3300005364 Bacteria 2927
12 Ga0070688_100030969 3300005365 Bacteria 3215
13 Ga0070667_100006931 3300005367 Bacteria 9414
14 Ga0070709_10002666 3300005434 Bacteria 9637
15 Ga0070694_100063881 3300005444 Bacteria 2519
16 Ga0070708_100336173 3300005445 Bacteria 1423
17 Ga0070708_100394637 3300005445 Bacteria 1305
18 Ga0070707_100026804 3300005468 Bacteria 5474
19 Ga0070698_100025659 3300005471 Bacteria 6140
20 Ga0070684_100025204 3300005535 Bacteria 4997
21 Ga0070697_100155173 3300005536 Bacteria 1932
22 Ga0070672_100055428 3300005543 Bacteria 3105
23 Ga0070686_100001696 3300005544 Bacteria 12329
24 Ga0070686_100065960 3300005544 Bacteria 2353
25 Ga0070696_100016094 3300005546 Bacteria 5030
26 Ga0070665_100018116 3300005548 Bacteria 7065
27 Ga0070664_100007225 3300005564 Bacteria 8962
28 Ga0070702_100007378 3300005615 Bacteria 5263
29 Ga0068859_100007211 3300005617 Bacteria 11279
30 Ga0068864_100305901 3300005618 Bacteria 1489
31 Ga0068863_100005806 3300005841 Bacteria 12097
32 Ga0068858_100002751 3300005842 Bacteria 17683
33 Ga0068860_100111748 3300005843 Bacteria 2613
34 Ga0070716_100200200 3300006173 Bacteria 1327
35 Ga0075367_10019111 3300006178 Bacteria 3794
36 Ga0068871_100015069 3300006358 Bacteria 5777
37 Ga0075431_100005002 3300006847 Bacteria 13042
38 Ga0075433_10078790 3300006852 Bacteria 2903
39 Ga0097620_100007211 3300006931 Bacteria 11279
40 Ga0075435_100018650 3300007076 Bacteria 5284
41 Ga0105245_10017975 3300009098 Bacteria 6175
42 Ga0114129_10103519 3300009147 Bacteria 3936
43 Ga0105248_10022319 3300009177 Bacteria 7019
44 Ga0099796_10025795 3300010159 Bacteria 1860
45 Ga0105239_10062080 3300010375 Bacteria 4102
46 Ga0105246_10010041 3300011119 Bacteria 5842
47 Ga0157374_10004982 3300013296 Bacteria 11142
48 Ga0157375_10010548 3300013308 Bacteria 8134
49 Ga0163163_10016978 3300014325 Bacteria 6778
50 Ga0157379_10015749 3300014968 Bacteria 6645
51 Ga0157376_10232966 3300014969 Bacteria 1712
52 Ga0207680_10022377 3300025903 Bacteria 3436
53 Ga0207684_10219015 3300025910 Bacteria 1643
54 Ga0207650_10060457 3300025925 Bacteria 2827
55 Ga0207691_10012755 3300025940 Bacteria 8046
56 Ga0207711_10002786 3300025941 Bacteria 15376
57 Ga0207661_10232864 3300025944 Bacteria 1632
58 Ga0207679_10038428 3300025945 Bacteria 3410
59 Ga0207651_10159354 3300025960 Bacteria 1767
60 Ga0207651_10259720 3300025960 Bacteria 1425
61 Ga0207677_10068113 3300026023 Bacteria 2496
62 Ga0207641_10026006 3300026088 Bacteria 4828
63 Ga0207676_10039096 3300026095 Bacteria 3626
64 Ga0268266_10087751 3300028379 Bacteria 2722
65 Ga0268264_10086158 3300028381 Bacteria 2698
66 Ga0265337_1001773 3300028556 Bacteria 10402
67 Ga0265337_1012292 3300028556 Unclassified 2916
68 Ga0265326_10002514 3300028558 Bacteria 6171
69 Ga0265326_10005447 3300028558 Bacteria 4013
70 Ga0265319_1003463 3300028563 Bacteria 8213
71 Ga0265319_1010185 3300028563 Bacteria 3940
72 Ga0265334_10014369 3300028573 Bacteria 3301
73 Ga0265318_10004162 3300028577 Bacteria 7071
74 Ga0265323_10001046 3300028653 Bacteria 14348
75 Ga0265323_10007625 3300028653 Bacteria 4487
76 Ga0265323_10027257 3300028653 Bacteria 2147
77 Ga0265322_10001250 3300028654 Bacteria 8639
78 Ga0265336_10000067 3300028666 Bacteria 93268
79 Ga0265336_10000287 3300028666 Bacteria 34809
80 Ga0265338_10000126 3300028800 Bacteria 140495
81 Ga0265338_10001417 3300028800 Bacteria 39003
82 Ga0265338_10005307 3300028800 Bacteria 16876
83 Ga0265338_10058305 3300028800 Bacteria 3409
84 Ga0265324_10003013 3300029957 Bacteria 8230
85 Ga0265324_10020401 3300029957 Bacteria 2382
86 Ga0265324_10027401 3300029957 Bacteria 2013
87 Ga0265330_10015548 3300031235 Bacteria 3519
88 Ga0265332_10003484 3300031238 Bacteria 7578
89 Ga0265332_10036157 3300031238 Bacteria 2144
90 Ga0265328_10012784 3300031239 Unclassified 3338
91 Ga0265320_10000946 3300031240 Bacteria 21662
92 Ga0265325_10009453 3300031241 Bacteria 5690
93 Ga0265325_10049536 3300031241 Bacteria 2167
94 Ga0265329_10000499 3300031242 Bacteria 20340
95 Ga0265340_10005356 3300031247 Bacteria 7125
96 Ga0265340_10015814 3300031247 Bacteria 3916
97 Ga0265340_10031571 3300031247 Bacteria 2648
98 Ga0265339_10000658 3300031249 Bacteria 26661
99 Ga0265339_10041086 3300031249 Bacteria 2569
100 Ga0265339_10049191 3300031249 Bacteria 2310
101 Ga0265339_10085662 3300031249 Bacteria 1659
102 Ga0265331_10006897 3300031250 Bacteria 6634
103 Ga0265331_10015401 3300031250 Bacteria 4038
104 Ga0265316_10002233 3300031344 Bacteria 20318
105 Ga0265316_10036790 3300031344 Bacteria 3956
106 Ga0265316_10043354 3300031344 Unclassified 3586
107 Ga0265313_10006637 3300031595 Bacteria 8118
108 Ga0265313_10020579 3300031595 Unclassified 3637
109 Ga0316579_10007969 3300031691 Bacteria 4397
110 Ga0316579_10053633 3300031691 Bacteria 1889
111 Ga0265314_10000893 3300031711 Bacteria 35529
112 Ga0265342_10005129 3300031712 Bacteria 10083
113 Ga0265342_10005720 3300031712 Bacteria 9398
114 Ga0316576_10110557 3300031727 Bacteria 2060
115 Ga0316576_10212652 3300031727 Bacteria 1455
116 Ga0316578_10010757 3300031728 Bacteria 4760
117 Ga0316578_10086406 3300031728 Bacteria 1870
118 Ga0316577_10012304 3300031733 Bacteria 4661
119 Ga0316577_10049445 3300031733 Bacteria 2347
120 Ga0316583_10030025 3300032133 Bacteria 1936
121 Ga0316583_10064080 3300032133 Bacteria 1287
122 Ga0316574_0069262 3300035398 Unclassified 2226
123 Ga0373931_0040219 3300035691 Bacteria 2453
124 Ga0373933_0058489 3300035724 Bacteria 2319
125 Ga0373937_0023044 3300036401 Bacteria 5602
126 Ga0373937_0519776 3300036401 Unclassified 1131
127 Ga0316582_0104389 3300036647 Bacteria 1880
128 Ga0316582_0198544 3300036647 Unclassified 1368
129 Ga0316584_0078646 3300036712 Bacteria 2470
130 Ga0316584_0092186 3300036712 Bacteria 2268
131 Ga0400484_23014 3300038725 Bacteria 10000
132 Ga0400490_36113 3300038726 Unclassified 4027
133 Ga0400488_56853 3300038741 Bacteria 8282
134 Ga0400486_11221 3300038742 Bacteria 3364
135 Ga0400487_22570 3300039110 Bacteria 4157
136 Ga0451577_0000612 3300042876 Bacteria 57520
137 Ga0451577_0002090 3300042876 Bacteria 24578
138 Ga0451577_0003276 3300042876 Bacteria 18219
139 Ga0451577_0003750 3300042876 Bacteria 16565
140 Ga0451577_0100342 3300042876 Bacteria 2586
141 Ga0451577_0160557 3300042876 Bacteria 2024
142 Ga0451577_0170847 3300042876 Bacteria 1959
143 Ga0453683_0000642 3300044673 Bacteria 37718
144 Ga0453683_0001156 3300044673 Bacteria 23912
145 Ga0453684_0000252 3300044712 Bacteria 231665
146 Ga0453684_0000739 3300044712 Bacteria 114375
147 Ga0453684_0005735 3300044712 Bacteria 24263
148 Ga0453684_0014150 3300044712 Bacteria 12817
149 Ga0453684_0040436 3300044712 Bacteria 6331
150 Ga0453684_0099352 3300044712 Bacteria 3565
151 Ga0453684_0332096 3300044712 Bacteria 1719
152 Ga0453684_0408137 3300044712 Bacteria 1520
153 Ga0451576_0006739 3300045051 Bacteria 13988
154 Ga0451576_0036078 3300045051 Bacteria 5244
155 Ga0451576_0561825 3300045051 Bacteria 1199
156 Ga0496106_0256445 3300048909 Bacteria 1399
157 Ga0496109_0110139 3300048912 Bacteria 2560
158 Ga0496112_0006418 3300048915 Bacteria 10320
159 Ga0501034_0183770 3300049571 Bacteria 2055
160 Ga0501040_0004168 3300049576 Bacteria 9410
161 nmdc:mga00v17_91160_c1 3300050491 Bacteria 1914
162 nmdc:mga05p37_13114_c1 3300050507 Bacteria 9920
163 nmdc:mga05p37_148420_c1 3300050507 Bacteria 2870
164 nmdc:mga06r32_4383_c1 3300050510 Bacteria 12620
165 nmdc:mga0n895_103424_c1 3300050512 Bacteria 2860
166 nmdc:mga0a205_61718_c1 3300050515 Bacteria 3621
167 Ga0500641_0001203 3300053096 Bacteria 9231
168 Ga0316584_0034229
169 Ga0065707_10092541
170 Ga0070683_100336749
171 Ga0070690_100001927
172 Ga0070690_100056586
173 Ga0070670_100019355
174 Ga0070666_10006917
175 Ga0070687_100000949
176 Ga0070671_100024275
177 Ga0070673_100008677
178 Ga0070673_100064046
179 Ga0070688_100030969
180 Ga0070667_100006931
181 Ga0070709_10002666
182 Ga0070694_100063881
183 Ga0070708_100336173
184 Ga0070708_100394637
185 Ga0070707_100026804
186 Ga0070698_100025659
187 Ga0070684_100025204
188 Ga0070697_100155173
189 Ga0070672_100055428
190 Ga0070686_100001696
191 Ga0070686_100065960
192 Ga0070696_100016094
193 Ga0070665_100018116
194 Ga0070664_100007225
195 Ga0070702_100007378
196 Ga0068859_100007211
197 Ga0068864_100305901
198 Ga0068863_100005806
199 Ga0068858_100002751
200 Ga0068860_100111748
201 Ga0070716_100200200
202 Ga0075367_10019111
203 Ga0068871_100015069
204 Ga0075431_100005002
205 Ga0075433_10078790
206 Ga0097620_100007211
207 Ga0075435_100018650
208 Ga0105245_10017975
209 Ga0114129_10103519
210 Ga0105248_10022319
211 Ga0099796_10025795
212 Ga0105239_10062080
213 Ga0105246_10010041
214 Ga0157374_10004982
215 Ga0157375_10010548
216 Ga0163163_10016978
217 Ga0157379_10015749
218 Ga0157376_10232966
219 Ga0207680_10022377
220 Ga0207684_10219015
221 Ga0207650_10060457
222 Ga0207691_10012755
223 Ga0207711_10002786
224 Ga0207661_10232864
225 Ga0207679_10038428
226 Ga0207651_10159354
227 Ga0207651_10259720
228 Ga0207677_10068113
229 Ga0207641_10026006
230 Ga0207676_10039096
231 Ga0268266_10087751
232 Ga0268264_10086158
233 Ga0265337_1001773
234 Ga0265337_1012292
235 Ga0265326_10002514
236 Ga0265326_10005447
237 Ga0265319_1003463
238 Ga0265319_1010185
239 Ga0265334_10014369
240 Ga0265318_10004162
241 Ga0265323_10001046
242 Ga0265323_10007625
243 Ga0265323_10027257
244 Ga0265322_10001250
245 Ga0265336_10000067
246 Ga0265336_10000287
247 Ga0265338_10000126
248 Ga0265338_10001417
249 Ga0265338_10005307
250 Ga0265338_10058305
251 Ga0265324_10003013
252 Ga0265324_10020401
253 Ga0265324_10027401
254 Ga0265330_10015548
255 Ga0265332_10003484
256 Ga0265332_10036157
257 Ga0265328_10012784
258 Ga0265320_10000946
259 Ga0265325_10009453
260 Ga0265325_10049536
261 Ga0265329_10000499
262 Ga0265340_10005356
263 Ga0265340_10015814
264 Ga0265340_10031571
265 Ga0265339_10000658
266 Ga0265339_10041086
267 Ga0265339_10049191
268 Ga0265339_10085662
269 Ga0265331_10006897
270 Ga0265331_10015401
271 Ga0265316_10002233
272 Ga0265316_10036790
273 Ga0265316_10043354
274 Ga0265313_10006637
275 Ga0265313_10020579
276 Ga0316579_10007969
277 Ga0316579_10053633
278 Ga0265314_10000893
279 Ga0265342_10005129
280 Ga0265342_10005720
281 Ga0316576_10110557
282 Ga0316576_10212652
283 Ga0316578_10010757
284 Ga0316578_10086406
285 Ga0316577_10012304
286 Ga0316577_10049445
287 Ga0316583_10030025
288 Ga0316583_10064080
289 Ga0316574_0069262
290 Ga0373931_0040219
291 Ga0373933_0058489
292 Ga0373937_0023044
293 Ga0373937_0519776
294 Ga0316582_0104389
295 Ga0316582_0198544
296 Ga0316584_0078646
297 Ga0316584_0092186
298 Ga0400484_23014
299 Ga0400490_36113
300 Ga0400488_56853
301 Ga0400486_11221
302 Ga0400487_22570
303 Ga0451577_0000612
304 Ga0451577_0002090
305 Ga0451577_0003276
306 Ga0451577_0003750
307 Ga0451577_0100342
308 Ga0451577_0160557
309 Ga0451577_0170847
310 Ga0453683_0000642
311 Ga0453683_0001156
312 Ga0453684_0000252
313 Ga0453684_0000739
314 Ga0453684_0005735
315 Ga0453684_0014150
316 Ga0453684_0040436
317 Ga0453684_0099352
318 Ga0453684_0332096
319 Ga0453684_0408137
320 Ga0451576_0006739
321 Ga0451576_0036078
322 Ga0451576_0561825
323 Ga0496106_0256445
324 Ga0496109_0110139
325 Ga0496112_0006418
326 Ga0501034_0183770
327 Ga0501040_0004168
328 nmdc:mga00v17_91160_c1
329 nmdc:mga05p37_13114_c1
330 nmdc:mga05p37_148420_c1
331 nmdc:mga06r32_4383_c1
332 nmdc:mga0n895_103424_c1
333 nmdc:mga0a205_61718_c1
334 Ga0500641_0001203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

81

215

0.98

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

219

431

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vhv-assembly1.cif.gz_A crystal structure of the d270a mutant of l-alanine dehydrogenase from mycobacterium tuberculosis in complex with nadh. 0.962 1 366
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9617 1 366
2vhw-assembly1.cif.gz_F crystal structure of holo l-alanine dehydrogenase from mycobacterium tuberculosis in the open and closed conformation 0.9596 1 366
2vhx-assembly1.cif.gz_D crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9542 1 366
2eez-assembly1.cif.gz_F crystal structure of alanine dehydrogenase from themus thermophilus 0.9526 1 366
ID Description Score Start End Superfamily
af_A0A1D6E3F3_39_301_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9882 169 202 3.50.50.60
af_A0A0P0WM81_180_403_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9848 170 200 3.50.50.60
af_Q5I0K1_8_223_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9808 172 202 3.50.50.60
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9805 132 306 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.976 170 202 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A352CBD0-F1-model_v4 Alanine dehydrogenase 0.9941 147 238 GO:0000286
GO:0005886
GO:0006524
AF-A0A4U2ML33-F1-model_v4 Alanine dehydrogenase 0.9921 131 253 GO:0000286
GO:0005886
GO:0006524
AF-A0A1R0WKH8-F1-model_v4 deleted 0.9906 131 306
AF-A0A800J9C3-F1-model_v4 Alanine dehydrogenase 0.9899 1 103 GO:0000286
GO:0005886
GO:0006524
AF-A0A534VM82-F1-model_v4 Alanine dehydrogenase 0.9896 221 340 GO:0000286
GO:0005886
GO:0006524

Map