F250679

General Info

Members Datasets Scaffolds Average Seq Length
167 116 334 264

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_10133887|Ga0207651_101338872
Length 315
Sequence MAGIPTARAELPRPILSLGQFATAVVVACWWGRLYNLSPMSMNSSSNAVAAAPRALWLPALSLARRELVRFLRQRNRIIGALATPIVFWLLIGAGMNRSFKSDVPGGENYLHYFFPGTLLMILLFTAIFSTISVIEDRREGFLQGVLVAPVSRMSIVLGKVLGGTILATGQGVVFLLLAPTVGIGLSVTSFVLTIVTMFVVSFALTAMGLAIAWRMTSTQGFHAIMNLFLVPLWFLSGALFPESGAWAGLRWVMRVNPLRYELVALRRAIYWNEPSVPAWMPGFAFSFAVSVVFALAMWLLASAVAKGRTTADLE

Samples

Sample ID Description Type Environment
1 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
103 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 0
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 20.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207651_10133887 3300025960 Bacteria 1903
2 JGI25406J46586_10050834 3300003203 Unclassified 1391
3 rootH2_10029069 3300003320 Bacteria 5233
4 Ga0065707_10085480 3300005295 Bacteria 6124
5 Ga0070690_100071477 3300005330 Bacteria 2255
6 Ga0070670_100244657 3300005331 Bacteria 1562
7 Ga0070677_10016401 3300005333 Bacteria 2637
8 Ga0068869_100304751 3300005334 Bacteria 1287
9 Ga0070666_10026318 3300005335 Bacteria 3799
10 Ga0070666_10140967 3300005335 Bacteria 1679
11 Ga0070689_100216576 3300005340 Bacteria 1569
12 Ga0070669_100225341 3300005353 Unclassified 1483
13 Ga0070675_100103797 3300005354 Bacteria 2397
14 Ga0070675_100202973 3300005354 Bacteria 1721
15 Ga0070675_100208217 3300005354 Unclassified 1699
16 Ga0070674_100015787 3300005356 Bacteria 4724
17 Ga0070673_100077417 3300005364 Bacteria 2688
18 Ga0070667_100226633 3300005367 Unclassified 1665
19 Ga0070667_100691885 3300005367 Unclassified 943
20 Ga0070709_10427043 3300005434 Unclassified 994
21 Ga0070713_100673807 3300005436 Bacteria 986
22 Ga0070708_100294921 3300005445 Bacteria 1527
23 Ga0068867_100303402 3300005459 Bacteria 1317
24 Ga0070706_100296157 3300005467 Unclassified 1510
25 Ga0070706_100500007 3300005467 Bacteria 1131
26 Ga0070707_100608781 3300005468 Unclassified 1055
27 Ga0070698_100190752 3300005471 Bacteria 1987
28 Ga0070672_100087325 3300005543 Bacteria 2509
29 Ga0070696_100085628 3300005546 Bacteria 2237
30 Ga0070665_100000772 3300005548 Bacteria 42151
31 Ga0070665_100153719 3300005548 Bacteria 2303
32 Ga0070664_100159861 3300005564 Bacteria 1993
33 Ga0068856_100307231 3300005614 Bacteria 1604
34 Ga0068864_100290156 3300005618 Bacteria 1529
35 Ga0068863_100046966 3300005841 Unclassified 4098
36 Ga0068860_100170785 3300005843 Bacteria 2100
37 Ga0081455_10001009 3300005937 Bacteria 35624
38 Ga0081455_10035129 3300005937 Unclassified 4483
39 Ga0081538_10003457 3300005981 Bacteria 14918
40 Ga0081540_1006541 3300005983 Bacteria 8464
41 Ga0081539_10020840 3300005985 Bacteria 4405
42 Ga0081539_10112755 3300005985 Bacteria 1365
43 Ga0070717_10552510 3300006028 Unclassified 1043
44 Ga0075432_10115830 3300006058 Unclassified 1003
45 Ga0075362_10013125 3300006177 Bacteria 3308
46 Ga0075428_100003946 3300006844 Bacteria 16276
47 Ga0075428_100007187 3300006844 Bacteria 12331
48 Ga0075428_100028846 3300006844 Bacteria 6141
49 Ga0075428_100188450 3300006844 Bacteria 2231
50 Ga0075428_100188819 3300006844 Unclassified 2229
51 Ga0075428_100669861 3300006844 Bacteria 1106
52 Ga0075430_100164814 3300006846 Unclassified 1844
53 Ga0075431_100036981 3300006847 Bacteria 5029
54 Ga0075431_100284392 3300006847 Bacteria 1674
55 Ga0075429_100008516 3300006880 Bacteria 8924
56 Ga0111539_10226952 3300009094 Bacteria 2175
57 Ga0111539_10616263 3300009094 Unclassified 1264
58 Ga0111539_10755408 3300009094 Unclassified 1132
59 Ga0105245_10765728 3300009098 Unclassified 1002
60 Ga0105247_10388944 3300009101 Unclassified 991
61 Ga0114129_10021795 3300009147 Bacteria 9095
62 Ga0114129_10616901 3300009147 Bacteria 1403
63 Ga0105241_10798094 3300009174 Bacteria 869
64 Ga0105249_10070695 3300009553 Bacteria 3222
65 Ga0105249_10072753 3300009553 Bacteria 3178
66 Ga0105249_10096589 3300009553 Bacteria 2773
67 Ga0105239_10278335 3300010375 Bacteria 1883
68 Ga0157373_10403403 3300013100 Bacteria 980
69 Ga0157370_10035148 3300013104 Bacteria 4874
70 Ga0157370_10109539 3300013104 Bacteria 2582
71 Ga0157369_10063661 3300013105 Unclassified 3973
72 Ga0157369_10240941 3300013105 Bacteria 1889
73 Ga0157369_10836500 3300013105 Bacteria 945
74 Ga0157374_10440575 3300013296 Bacteria 1303
75 Ga0163162_10058461 3300013306 Bacteria 3885
76 Ga0163162_10076880 3300013306 Bacteria 3401
77 Ga0163162_10372416 3300013306 Bacteria 1561
78 Ga0157372_10062268 3300013307 Bacteria 4180
79 Ga0157375_10184734 3300013308 Bacteria 2238
80 Ga0157380_10241246 3300014326 Bacteria 1630
81 Ga0157379_10003101 3300014968 Bacteria 14055
82 Ga0157379_10163649 3300014968 Bacteria 2008
83 Ga0157376_10216172 3300014969 Bacteria 1772
84 Ga0207682_10009617 3300025893 Bacteria 3810
85 Ga0207680_10035495 3300025903 Bacteria 2863
86 Ga0207680_10132808 3300025903 Bacteria 1642
87 Ga0207695_10000095 3300025913 Bacteria 265435
88 Ga0207662_10316807 3300025918 Bacteria 1040
89 Ga0207646_10161252 3300025922 Bacteria 2024
90 Ga0207681_10042030 3300025923 Bacteria 3051
91 Ga0207681_10281345 3300025923 Bacteria 1310
92 Ga0207650_10070365 3300025925 Bacteria 2630
93 Ga0207659_10053545 3300025926 Bacteria 2879
94 Ga0207659_10295379 3300025926 Unclassified 1329
95 Ga0207664_10561174 3300025929 Unclassified 1025
96 Ga0207670_10181449 3300025936 Bacteria 1586
97 Ga0207665_10041155 3300025939 Bacteria 3085
98 Ga0207665_10046200 3300025939 Bacteria 2918
99 Ga0207691_10040525 3300025940 Bacteria 4302
100 Ga0207679_10212278 3300025945 Bacteria 1624
101 Ga0207651_10128234 3300025960 Bacteria 1937
102 Ga0207712_10065382 3300025961 Bacteria 2595
103 Ga0207712_10165127 3300025961 Bacteria 1725
104 Ga0207641_10101380 3300026088 Bacteria 2537
105 Ga0207676_10334279 3300026095 Bacteria 1395
106 Ga0207428_10041175 3300027907 Bacteria 3742
107 Ga0268266_10001307 3300028379 Bacteria 30263
108 Ga0268264_10028629 3300028381 Bacteria 4559
109 Ga0265338_10117860 3300028800 Unclassified 2123
110 Ga0265314_10000779 3300031711 Bacteria 37875
111 Ga0307413_10052838 3300031824 Bacteria 2457
112 Ga0307413_10070361 3300031824 Bacteria 2200
113 Ga0307410_10016172 3300031852 Bacteria 4443
114 Ga0307409_100119951 3300031995 Bacteria 2225
115 Ga0307409_100207076 3300031995 Bacteria 1760
116 Ga0373926_0051386 3300035083 Bacteria 1487
117 Ga0373946_0067902 3300035171 Unclassified 1532
118 Ga0373935_0034918 3300035692 Bacteria 3136
119 Ga0373927_0004562 3300035695 Bacteria 9676
120 Ga0373927_0016305 3300035695 Bacteria 4902
121 Ga0373947_0009302 3300035725 Bacteria 5645
122 Ga0373947_0036018 3300035725 Bacteria 2932
123 Ga0373937_0124833 3300036401 Unclassified 2401
124 Ga0373925_0000074 3300037068 Bacteria 106196
125 Ga0373925_0009915 3300037068 Bacteria 6919
126 Ga0373925_0069548 3300037068 Unclassified 2659
127 Ga0395905_0181907 3300037471 Bacteria 1974
128 Ga0395901_0530378 3300038443 Bacteria 1195
129 Ga0436361_0376749 3300039447 Bacteria 1962
130 Ga0439450_020771 3300042008 Unclassified 1404
131 Ga0439460_0102153 3300042461 Unclassified 922
132 Ga0439440_0008852 3300042993 Bacteria 2073
133 Ga0453683_0159510 3300044673 Unclassified 1427
134 Ga0495580_0000838 3300046472 Bacteria 26628
135 Ga0495594_0262402 3300046499 Bacteria 984
136 Ga0501034_0056198 3300049571 Bacteria 3961
137 Ga0501041_0116691 3300049577 Bacteria 1658
138 Ga0501042_0163344 3300049578 Bacteria 1607
139 Ga0501076_0388685 3300049592 Bacteria 1147
140 Ga0501076_0398121 3300049592 Unclassified 1132
141 Ga0501081_0137723 3300049743 Bacteria 1748
142 Ga0501081_0167028 3300049743 Unclassified 1588
143 Ga0501044_0283100 3300049823 Bacteria 1591
144 Ga0501045_0136481 3300049824 Unclassified 1824
145 nmdc:mga03683_25323_c1 3300050489 Bacteria 2329
146 nmdc:mga05p37_43541_c1 3300050507 Bacteria 5523
147 nmdc:mga05p37_66507_c1 3300050507 Unclassified 4434
148 nmdc:mga09592_16182_c1 3300050508 Bacteria 6097
149 nmdc:mga09592_328562_c1 3300050508 Bacteria 1324
150 nmdc:mga09592_47477_c1 3300050508 Bacteria 3618
151 nmdc:mga09592_7135_c1 3300050508 Bacteria 9084
152 nmdc:mga0qj67_18187_c1 3300050509 Bacteria 5354
153 nmdc:mga0qj67_315645_c1 3300050509 Bacteria 1265
154 nmdc:mga0qj67_53877_c1 3300050509 Unclassified 3185
155 nmdc:mga0qj67_70583_c1 3300050509 Bacteria 2786
156 nmdc:mga06r32_200671_c1 3300050510 Viruses 1982
157 nmdc:mga06r32_27066_c1 3300050510 Bacteria 5353
158 nmdc:mga06r32_59504_c1 3300050510 Bacteria 3674
159 nmdc:mga08y16_105517_c1 3300050511 Bacteria 2933
160 nmdc:mga08y16_6921_c1 3300050511 Bacteria 11889
161 nmdc:mga0n895_156330_c1 3300050512 Bacteria 2311
162 nmdc:mga08x19_142522_c1 3300050514 Unclassified 1619
163 nmdc:mga08x19_49573_c1 3300050514 Bacteria 2693
164 nmdc:mga0a205_130541_c1 3300050515 Bacteria 2413
165 Ga0501082_0435118 3300060353 Bacteria 1146
166 Ga0530510_0085106 3300061734 Bacteria 2303
167 Ga0530510_0115927 3300061734 Unclassified 1964
168 Ga0207651_10133887
169 JGI25406J46586_10050834
170 rootH2_10029069
171 Ga0065707_10085480
172 Ga0070690_100071477
173 Ga0070670_100244657
174 Ga0070677_10016401
175 Ga0068869_100304751
176 Ga0070666_10026318
177 Ga0070666_10140967
178 Ga0070689_100216576
179 Ga0070669_100225341
180 Ga0070675_100103797
181 Ga0070675_100202973
182 Ga0070675_100208217
183 Ga0070674_100015787
184 Ga0070673_100077417
185 Ga0070667_100226633
186 Ga0070667_100691885
187 Ga0070709_10427043
188 Ga0070713_100673807
189 Ga0070708_100294921
190 Ga0068867_100303402
191 Ga0070706_100296157
192 Ga0070706_100500007
193 Ga0070707_100608781
194 Ga0070698_100190752
195 Ga0070672_100087325
196 Ga0070696_100085628
197 Ga0070665_100000772
198 Ga0070665_100153719
199 Ga0070664_100159861
200 Ga0068856_100307231
201 Ga0068864_100290156
202 Ga0068863_100046966
203 Ga0068860_100170785
204 Ga0081455_10001009
205 Ga0081455_10035129
206 Ga0081538_10003457
207 Ga0081540_1006541
208 Ga0081539_10020840
209 Ga0081539_10112755
210 Ga0070717_10552510
211 Ga0075432_10115830
212 Ga0075362_10013125
213 Ga0075428_100003946
214 Ga0075428_100007187
215 Ga0075428_100028846
216 Ga0075428_100188450
217 Ga0075428_100188819
218 Ga0075428_100669861
219 Ga0075430_100164814
220 Ga0075431_100036981
221 Ga0075431_100284392
222 Ga0075429_100008516
223 Ga0111539_10226952
224 Ga0111539_10616263
225 Ga0111539_10755408
226 Ga0105245_10765728
227 Ga0105247_10388944
228 Ga0114129_10021795
229 Ga0114129_10616901
230 Ga0105241_10798094
231 Ga0105249_10070695
232 Ga0105249_10072753
233 Ga0105249_10096589
234 Ga0105239_10278335
235 Ga0157373_10403403
236 Ga0157370_10035148
237 Ga0157370_10109539
238 Ga0157369_10063661
239 Ga0157369_10240941
240 Ga0157369_10836500
241 Ga0157374_10440575
242 Ga0163162_10058461
243 Ga0163162_10076880
244 Ga0163162_10372416
245 Ga0157372_10062268
246 Ga0157375_10184734
247 Ga0157380_10241246
248 Ga0157379_10003101
249 Ga0157379_10163649
250 Ga0157376_10216172
251 Ga0207682_10009617
252 Ga0207680_10035495
253 Ga0207680_10132808
254 Ga0207695_10000095
255 Ga0207662_10316807
256 Ga0207646_10161252
257 Ga0207681_10042030
258 Ga0207681_10281345
259 Ga0207650_10070365
260 Ga0207659_10053545
261 Ga0207659_10295379
262 Ga0207664_10561174
263 Ga0207670_10181449
264 Ga0207665_10041155
265 Ga0207665_10046200
266 Ga0207691_10040525
267 Ga0207679_10212278
268 Ga0207651_10128234
269 Ga0207712_10065382
270 Ga0207712_10165127
271 Ga0207641_10101380
272 Ga0207676_10334279
273 Ga0207428_10041175
274 Ga0268266_10001307
275 Ga0268264_10028629
276 Ga0265338_10117860
277 Ga0265314_10000779
278 Ga0307413_10052838
279 Ga0307413_10070361
280 Ga0307410_10016172
281 Ga0307409_100119951
282 Ga0307409_100207076
283 Ga0373926_0051386
284 Ga0373946_0067902
285 Ga0373935_0034918
286 Ga0373927_0004562
287 Ga0373927_0016305
288 Ga0373947_0009302
289 Ga0373947_0036018
290 Ga0373937_0124833
291 Ga0373925_0000074
292 Ga0373925_0009915
293 Ga0373925_0069548
294 Ga0395905_0181907
295 Ga0395901_0530378
296 Ga0436361_0376749
297 Ga0439450_020771
298 Ga0439460_0102153
299 Ga0439440_0008852
300 Ga0453683_0159510
301 Ga0495580_0000838
302 Ga0495594_0262402
303 Ga0501034_0056198
304 Ga0501041_0116691
305 Ga0501042_0163344
306 Ga0501076_0388685
307 Ga0501076_0398121
308 Ga0501081_0137723
309 Ga0501081_0167028
310 Ga0501044_0283100
311 Ga0501045_0136481
312 nmdc:mga03683_25323_c1
313 nmdc:mga05p37_43541_c1
314 nmdc:mga05p37_66507_c1
315 nmdc:mga09592_16182_c1
316 nmdc:mga09592_328562_c1
317 nmdc:mga09592_47477_c1
318 nmdc:mga09592_7135_c1
319 nmdc:mga0qj67_18187_c1
320 nmdc:mga0qj67_315645_c1
321 nmdc:mga0qj67_53877_c1
322 nmdc:mga0qj67_70583_c1
323 nmdc:mga06r32_200671_c1
324 nmdc:mga06r32_27066_c1
325 nmdc:mga06r32_59504_c1
326 nmdc:mga08y16_105517_c1
327 nmdc:mga08y16_6921_c1
328 nmdc:mga0n895_156330_c1
329 nmdc:mga08x19_142522_c1
330 nmdc:mga08x19_49573_c1
331 nmdc:mga0a205_130541_c1
332 Ga0501082_0435118
333 Ga0530510_0085106
334 Ga0530510_0115927

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

60

271

0.91

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

80

304

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xjy-assembly1.cif.gz_A cryo-em structure of human abca1 0.7645 54 250
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.7549 49 245
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.7518 53 250
7w01-assembly1.cif.gz_A cryo-em structure of nucleotide-free abca3 0.7405 54 250
8wbx-assembly1.cif.gz_B cryo-em structure of the abcg25 bound to aba 0.7373 8 250
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8656 53 250 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8503 53 250 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8461 53 247 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6558 53 250 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6452 53 250 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A534QQM5-F1-model_v4 Multidrug ABC transporter permease 0.9766 53 251 GO:0043190
GO:0140359
AF-A0A537C6L3-F1-model_v4 Multidrug ABC transporter permease 0.9676 55 251 GO:0016020
GO:0140359
AF-A0A6B1F058-F1-model_v4 Multidrug ABC transporter permease 0.9666 67 254 GO:0016020
GO:0140359
AF-A0A7J2HAA6-F1-model_v4 deleted 0.9613 56 251
AF-A0A7Y5H975-F1-model_v4 Transport permease protein 0.961 1 249 GO:0043190
GO:0140359

Map