F249157

General Info

Members Datasets Scaffolds Average Seq Length
166 113 332 304

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0211452|Ga0496107_0211452_59_1087
Length 342
Sequence MMSPAKAQRRKEGRKGKLFFASSFAPLRLCGVIFLFHEGKPHNWHDLARAWSFEPLVTVSLLLSGLLFVIGLRRLWHEAPKRRSIRTWEALCFAGGWLALFVALVSPLHAWGSVLFSAHMTQHEVLMLVAAPLLVLGRPLIAFLWALPLNWSRGLGNVAKISWINRTWRTLTIPLVAWLVHAIALWVWHIPLLFEAVLHNEAVHTAQHLSFLLSALLFWWALIHGPQGAMGYGAAVLYVFTTSIHSGALGALITIAGSVWYPSYVGLTSSWGLTPLEDQQLGGLIMWIPAGLVYVIAGLALFAGWLRESELRAFSALPLRPLRLSGNGRLSTTEAQRTQRKA

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
99 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
100 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
101 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
102 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
103 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
104 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
105 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
106 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
107 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
108 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
109 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
110 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
111 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
112 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
113 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.01
Rhizosphere 93.37
Stem 0
Stem Tuber 0
Unclassified 12.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0211452 3300048910 Bacteria 1442
2 SwRhRL2b_contig_277485 2162886007 Bacteria 2945
3 JGI24751J29686_10000136 3300002459 Bacteria 36776
4 JGI25406J46586_10007404 3300003203 Bacteria 5010
5 JGI25406J46586_10015640 3300003203 Bacteria 3193
6 JGI25406J46586_10029794 3300003203 Bacteria 2061
7 rootH2_10075660 3300003320 Bacteria 12021
8 rootL2_10090457 3300003322 Unclassified 1674
9 rootH1_10245196 3300003323 Unclassified 1949
10 Ga0065714_10064474 3300005288 Bacteria 60308
11 Ga0065704_10001928 3300005289 Bacteria 11405
12 Ga0065712_10067750 3300005290 Bacteria 60312
13 Ga0065712_10070116 3300005290 Bacteria 6314
14 Ga0065715_10090953 3300005293 Bacteria 6280
15 Ga0065707_10104734 3300005295 Bacteria 2681
16 Ga0070670_100000098 3300005331 Bacteria 80608
17 Ga0070670_100015554 3300005331 Bacteria 6535
18 Ga0070670_100079938 3300005331 Bacteria 2810
19 Ga0070670_100279982 3300005331 Bacteria 1456
20 Ga0068869_100020141 3300005334 Bacteria 4569
21 Ga0068869_100271085 3300005334 Bacteria 1362
22 Ga0070687_100136462 3300005343 Bacteria 1423
23 Ga0070692_10144243 3300005345 Bacteria 1351
24 Ga0070669_100000761 3300005353 Bacteria 23446
25 Ga0070671_100001611 3300005355 Bacteria 17011
26 Ga0070673_100324779 3300005364 Bacteria 1360
27 Ga0070703_10106245 3300005406 Unclassified 997
28 Ga0070709_10318280 3300005434 Bacteria 1141
29 Ga0070705_100003263 3300005440 Bacteria 7977
30 Ga0070694_100002769 3300005444 Bacteria 10403
31 Ga0070694_100003204 3300005444 Bacteria 9765
32 Ga0070694_100250299 3300005444 Bacteria 1340
33 Ga0070681_10006697 3300005458 Bacteria 11209
34 Ga0070681_10144085 3300005458 Bacteria 2312
35 Ga0068853_100018847 3300005539 Bacteria 5715
36 Ga0070696_100007127 3300005546 Bacteria 7467
37 Ga0070696_100036470 3300005546 Bacteria 3390
38 Ga0070693_100002445 3300005547 Bacteria 8557
39 Ga0070693_100045832 3300005547 Bacteria 2480
40 Ga0070693_100100517 3300005547 Bacteria 1761
41 Ga0070693_100220169 3300005547 Unclassified 1243
42 Ga0070704_100471242 3300005549 Bacteria 1085
43 Ga0070664_100391487 3300005564 Bacteria 1270
44 Ga0068854_100042322 3300005578 Unclassified 3224
45 Ga0070702_100010707 3300005615 Bacteria 4531
46 Ga0070702_100040718 3300005615 Bacteria 2601
47 Ga0068852_100314625 3300005616 Unclassified 1519
48 Ga0068859_100012645 3300005617 Bacteria 8484
49 Ga0068859_100327314 3300005617 Bacteria 1626
50 Ga0068859_100629135 3300005617 Bacteria 1166
51 Ga0068864_100170068 3300005618 Unclassified 1987
52 Ga0068851_10001358 3300005834 Bacteria 10679
53 Ga0068870_10086592 3300005840 Bacteria 1743
54 Ga0068863_100083818 3300005841 Bacteria 3021
55 Ga0068863_100104670 3300005841 Unclassified 2692
56 Ga0068858_100038049 3300005842 Bacteria 4462
57 Ga0068860_100313404 3300005843 Bacteria 1539
58 Ga0081539_10000119 3300005985 Bacteria 184136
59 Ga0081539_10000227 3300005985 Bacteria 132022
60 Ga0081539_10000592 3300005985 Bacteria 74017
61 Ga0081539_10000884 3300005985 Bacteria 57334
62 Ga0075432_10075009 3300006058 Bacteria 1219
63 Ga0070716_100330810 3300006173 Bacteria 1071
64 Ga0075433_10115248 3300006852 Bacteria 2384
65 Ga0097620_100012645 3300006931 Bacteria 8484
66 Ga0097620_100327297 3300006931 Bacteria 1626
67 Ga0097620_100629131 3300006931 Bacteria 1166
68 Ga0105240_10178065 3300009093 Bacteria 2512
69 Ga0105240_10720249 3300009093 Bacteria 1087
70 Ga0111539_10001532 3300009094 Bacteria 30761
71 Ga0105247_10000841 3300009101 Bacteria 23337
72 Ga0114129_10028568 3300009147 Bacteria 7903
73 Ga0114129_10098668 3300009147 Bacteria 4043
74 Ga0105243_10213254 3300009148 Bacteria 1702
75 Ga0105241_10003816 3300009174 Bacteria 11170
76 Ga0105241_10087550 3300009174 Bacteria 2451
77 Ga0105242_10023657 3300009176 Unclassified 4843
78 Ga0105248_10001687 3300009177 Bacteria 24588
79 Ga0105237_10000199 3300009545 Bacteria 85277
80 Ga0105237_10130828 3300009545 Bacteria 2504
81 Ga0105237_10209542 3300009545 Bacteria 1949
82 Ga0105239_10590967 3300010375 Bacteria 1266
83 Ga0157370_10204750 3300013104 Unclassified 1830
84 Ga0157372_10099725 3300013307 Bacteria 3313
85 Ga0157372_10327742 3300013307 Bacteria 1783
86 Ga0163163_10000465 3300014325 Bacteria 36944
87 Ga0157380_11151829 3300014326 Bacteria 817
88 Ga0157379_10029754 3300014968 Bacteria 4856
89 Ga0157379_10228583 3300014968 Bacteria 1686
90 Ga0157379_10389199 3300014968 Bacteria 1280
91 Ga0213876_10000350 3300021384 Bacteria 39862
92 Ga0207656_10025370 3300025321 Bacteria 2406
93 Ga0207653_10021894 3300025885 Bacteria 2029
94 Ga0207710_10000563 3300025900 Bacteria 22203
95 Ga0207707_10005841 3300025912 Bacteria 10754
96 Ga0207695_10100888 3300025913 Bacteria 2881
97 Ga0207671_10001814 3300025914 Bacteria 23845
98 Ga0207671_10096364 3300025914 Unclassified 2235
99 Ga0207694_10114107 3300025924 Bacteria 2152
100 Ga0207650_10000156 3300025925 Bacteria 81983
101 Ga0207650_10002634 3300025925 Bacteria 12419
102 Ga0207650_10167954 3300025925 Bacteria 1742
103 Ga0207686_10175517 3300025934 Bacteria 1515
104 Ga0207665_10274100 3300025939 Bacteria 1254
105 Ga0207711_10207819 3300025941 Unclassified 1788
106 Ga0207689_10338941 3300025942 Bacteria 1249
107 Ga0207679_10023100 3300025945 Bacteria 4246
108 Ga0207679_10193595 3300025945 Bacteria 1693
109 Ga0207667_10041324 3300025949 Unclassified 4905
110 Ga0207640_10245913 3300025981 Bacteria 1385
111 Ga0207703_10045389 3300026035 Bacteria 3535
112 Ga0207708_10123122 3300026075 Unclassified 2022
113 Ga0207641_10085660 3300026088 Bacteria 2746
114 Ga0207641_10158914 3300026088 Unclassified 2053
115 Ga0207648_10106418 3300026089 Bacteria 2461
116 Ga0207676_10211045 3300026095 Bacteria 1722
117 Ga0207428_10053198 3300027907 Bacteria 3229
118 Ga0268264_10109147 3300028381 Bacteria 2420
119 Ga0307408_100003938 3300031548 Bacteria 10115
120 Ga0307408_100042403 3300031548 Bacteria 3232
121 Ga0307410_10001978 3300031852 Bacteria 9634
122 Ga0307410_10030840 3300031852 Bacteria 3431
123 Ga0307410_10072985 3300031852 Unclassified 2385
124 Ga0307406_10002927 3300031901 Bacteria 9294
125 Ga0307406_10071689 3300031901 Bacteria 2271
126 Ga0307407_10057267 3300031903 Bacteria 2260
127 Ga0307409_100007408 3300031995 Bacteria 6561
128 Ga0307416_100009648 3300032002 Bacteria 6333
129 Ga0307416_100064663 3300032002 Plasmid 3002
130 Ga0307416_100205879 3300032002 Bacteria 1872
131 Ga0307416_100617253 3300032002 Bacteria 1166
132 Ga0307414_10001159 3300032004 Bacteria 13522
133 Ga0307414_10173828 3300032004 Bacteria 1725
134 Ga0307411_10057988 3300032005 Bacteria 2561
135 Ga0373942_0041890 3300035207 Unclassified 1254
136 Ga0395905_0011104 3300037471 Bacteria 8712
137 Ga0395901_0287869 3300038443 Bacteria 1706
138 Ga0436365_1043533 3300039437 Bacteria 3076
139 Ga0436365_1600837 3300039437 Bacteria 192134
140 Ga0439455_0029426 3300042012 Bacteria 1358
141 Ga0496104_0019508 3300048907 Bacteria 6206
142 Ga0496112_0042638 3300048915 Bacteria 4440
143 Ga0496112_0278901 3300048915 Bacteria 1619
144 Ga0496113_0436747 3300048916 Bacteria 1052
145 Ga0501198_013130 3300049649 Bacteria 1251
146 Ga0501207_001010 3300049654 Bacteria 3419
147 Ga0501216_003138 3300049660 Bacteria 2394
148 Ga0501217_001674 3300049661 Bacteria 4216
149 Ga0501223_000491 3300049663 Bacteria 9573
150 Ga0501223_003563 3300049663 Bacteria 3371
151 Ga0501224_003418 3300049664 Bacteria 2213
152 Ga0501224_011179 3300049664 Unclassified 1319
153 Ga0501228_006574 3300049666 Bacteria 1065
154 Ga0501221_013894 3300049704 Bacteria 1488
155 Ga0501225_0000779 3300049705 Bacteria 9947
156 Ga0501234_001206 3300049707 Bacteria 4076
157 Ga0501279_009277 3300049775 Unclassified 1317
158 Ga0501212_003658 3300049851 Bacteria 1945
159 nmdc:mga05p37_125979_c1 3300050507 Bacteria 3145
160 nmdc:mga05p37_317961_c1 3300050507 Bacteria 1843
161 nmdc:mga05p37_361596_c1 3300050507 Bacteria 1706
162 nmdc:mga0n895_94376_c1 3300050512 Bacteria 2995
163 nmdc:mga0a205_103815_c1 3300050515 Unclassified 1450
164 nmdc:mga0a205_42796_c1 3300050515 Bacteria 4365
165 nmdc:mga0a205_73011_c1 3300050515 Bacteria 3315
166 nmdc:mga0a205_8543_c1 3300050515 Bacteria 9311
167 Ga0496107_0211452
168 SwRhRL2b_contig_277485
169 JGI24751J29686_10000136
170 JGI25406J46586_10007404
171 JGI25406J46586_10015640
172 JGI25406J46586_10029794
173 rootH2_10075660
174 rootL2_10090457
175 rootH1_10245196
176 Ga0065714_10064474
177 Ga0065704_10001928
178 Ga0065712_10067750
179 Ga0065712_10070116
180 Ga0065715_10090953
181 Ga0065707_10104734
182 Ga0070670_100000098
183 Ga0070670_100015554
184 Ga0070670_100079938
185 Ga0070670_100279982
186 Ga0068869_100020141
187 Ga0068869_100271085
188 Ga0070687_100136462
189 Ga0070692_10144243
190 Ga0070669_100000761
191 Ga0070671_100001611
192 Ga0070673_100324779
193 Ga0070703_10106245
194 Ga0070709_10318280
195 Ga0070705_100003263
196 Ga0070694_100002769
197 Ga0070694_100003204
198 Ga0070694_100250299
199 Ga0070681_10006697
200 Ga0070681_10144085
201 Ga0068853_100018847
202 Ga0070696_100007127
203 Ga0070696_100036470
204 Ga0070693_100002445
205 Ga0070693_100045832
206 Ga0070693_100100517
207 Ga0070693_100220169
208 Ga0070704_100471242
209 Ga0070664_100391487
210 Ga0068854_100042322
211 Ga0070702_100010707
212 Ga0070702_100040718
213 Ga0068852_100314625
214 Ga0068859_100012645
215 Ga0068859_100327314
216 Ga0068859_100629135
217 Ga0068864_100170068
218 Ga0068851_10001358
219 Ga0068870_10086592
220 Ga0068863_100083818
221 Ga0068863_100104670
222 Ga0068858_100038049
223 Ga0068860_100313404
224 Ga0081539_10000119
225 Ga0081539_10000227
226 Ga0081539_10000592
227 Ga0081539_10000884
228 Ga0075432_10075009
229 Ga0070716_100330810
230 Ga0075433_10115248
231 Ga0097620_100012645
232 Ga0097620_100327297
233 Ga0097620_100629131
234 Ga0105240_10178065
235 Ga0105240_10720249
236 Ga0111539_10001532
237 Ga0105247_10000841
238 Ga0114129_10028568
239 Ga0114129_10098668
240 Ga0105243_10213254
241 Ga0105241_10003816
242 Ga0105241_10087550
243 Ga0105242_10023657
244 Ga0105248_10001687
245 Ga0105237_10000199
246 Ga0105237_10130828
247 Ga0105237_10209542
248 Ga0105239_10590967
249 Ga0157370_10204750
250 Ga0157372_10099725
251 Ga0157372_10327742
252 Ga0163163_10000465
253 Ga0157380_11151829
254 Ga0157379_10029754
255 Ga0157379_10228583
256 Ga0157379_10389199
257 Ga0213876_10000350
258 Ga0207656_10025370
259 Ga0207653_10021894
260 Ga0207710_10000563
261 Ga0207707_10005841
262 Ga0207695_10100888
263 Ga0207671_10001814
264 Ga0207671_10096364
265 Ga0207694_10114107
266 Ga0207650_10000156
267 Ga0207650_10002634
268 Ga0207650_10167954
269 Ga0207686_10175517
270 Ga0207665_10274100
271 Ga0207711_10207819
272 Ga0207689_10338941
273 Ga0207679_10023100
274 Ga0207679_10193595
275 Ga0207667_10041324
276 Ga0207640_10245913
277 Ga0207703_10045389
278 Ga0207708_10123122
279 Ga0207641_10085660
280 Ga0207641_10158914
281 Ga0207648_10106418
282 Ga0207676_10211045
283 Ga0207428_10053198
284 Ga0268264_10109147
285 Ga0307408_100003938
286 Ga0307408_100042403
287 Ga0307410_10001978
288 Ga0307410_10030840
289 Ga0307410_10072985
290 Ga0307406_10002927
291 Ga0307406_10071689
292 Ga0307407_10057267
293 Ga0307409_100007408
294 Ga0307416_100009648
295 Ga0307416_100064663
296 Ga0307416_100205879
297 Ga0307416_100617253
298 Ga0307414_10001159
299 Ga0307414_10173828
300 Ga0307411_10057988
301 Ga0373942_0041890
302 Ga0395905_0011104
303 Ga0395901_0287869
304 Ga0436365_1043533
305 Ga0436365_1600837
306 Ga0439455_0029426
307 Ga0496104_0019508
308 Ga0496112_0042638
309 Ga0496112_0278901
310 Ga0496113_0436747
311 Ga0501198_013130
312 Ga0501207_001010
313 Ga0501216_003138
314 Ga0501217_001674
315 Ga0501223_000491
316 Ga0501223_003563
317 Ga0501224_003418
318 Ga0501224_011179
319 Ga0501228_006574
320 Ga0501221_013894
321 Ga0501225_0000779
322 Ga0501234_001206
323 Ga0501279_009277
324 Ga0501212_003658
325 nmdc:mga05p37_125979_c1
326 nmdc:mga05p37_317961_c1
327 nmdc:mga05p37_361596_c1
328 nmdc:mga0n895_94376_c1
329 nmdc:mga0a205_103815_c1
330 nmdc:mga0a205_42796_c1
331 nmdc:mga0a205_73011_c1
332 nmdc:mga0a205_8543_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09678

Caa3_CtaG

Cytochrome c oxidase caa3 assembly factor (Caa3_CtaG)

66

308

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5krw-assembly1.cif.gz_A recognition and targeting mechanisms by chaperones in flagella assembly and operation 0.4182 153 287
5krw-assembly1.cif.gz_A recognition and targeting mechanisms by chaperones in flagella assembly and operation 0.3783 153 287
7z14-assembly1.cif.gz_A cryo-em structure of torpedo nicotinic acetylcholine receptor in complex with a short-chain neurotoxin. 0.3434 156 292
4jq6-assembly1.cif.gz_B-2 crystal structure of blue light-absorbing proteorhodopsin from med12 at 2.3 angstrom 0.2911 49 294
4jq6-assembly1.cif.gz_B-2 crystal structure of blue light-absorbing proteorhodopsin from med12 at 2.3 angstrom 0.2879 49 294
ID Description Score Start End Superfamily
af_Q9VRD7_1_131_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4094 154 290 1.20.1070.10
af_A0A1D6E3A8_83_245_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3878 134 297 1.25.10.10
af_Q9VRD7_1_131_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3855 154 290 1.20.1070.10
af_A0A1D6HFL9_79_235_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.3781 134 299 1.25.10.10
af_F1QWG5_59_197_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3718 157 284 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7R6X710-F1-model_v4 Cytochrome c oxidase assembly protein 0.9042 75 301 GO:0005886
AF-A0A2V6W2K5-F1-model_v4 Cytochrome c oxidase assembly protein 0.9005 49 198 GO:0005886
AF-A0A2V7Z8Y5-F1-model_v4 Cytochrome c domain-containing protein 0.8939 44 304 GO:0005886
GO:0009055
GO:0020037
GO:0046872
AF-A0A7S8E7G1-F1-model_v4 Cytochrome c oxidase assembly protein 0.8939 29 300 GO:0005886
AF-A0A2V7W3G0-F1-model_v4 Cytochrome c domain-containing protein 0.8919 49 303 GO:0005886
GO:0009055
GO:0020037
GO:0046872

Map