F248951

General Info

Members Datasets Scaffolds Average Seq Length
166 110 166 111

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0090119|Ga0466968_0090119_86_481
Length 131
Sequence VNLDSRCNHRELGRYVDNPAVAYDEDLANRIRELLADEDGVIEKKMFGGLAFLIGGNMSVSASGQGGLLVHCDPAETEALLRKPHAEPFEMRGRAMDGWLRVAPEGVRTKRQLAPWVERGAAYARSLPAKG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
64 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
96 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
100 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
101 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
102 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
103 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
104 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
105 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
106 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
107 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
108 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
109 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
110 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 3.01
Rhizosphere 92.77
Stem 0
Stem Tuber 0
Unclassified 3.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10042285 3300001990 Bacteria 1397
2 Ga0070658_10717744 3300005327 Bacteria 868
3 Ga0070680_100169283 3300005336 Bacteria 1838
4 Ga0070668_100357722 3300005347 Bacteria 1237
5 Ga0070671_100122890 3300005355 Bacteria 2185
6 Ga0070671_101430989 3300005355 Unclassified 611
7 Ga0070709_11648469 3300005434 Bacteria 523
8 Ga0070714_100311188 3300005435 Bacteria 1470
9 Ga0070714_100967683 3300005435 Bacteria 828
10 Ga0070714_100990769 3300005435 Bacteria 818
11 Ga0070714_102161809 3300005435 Bacteria 542
12 Ga0070710_10357172 3300005437 Unclassified 969
13 Ga0070694_100371075 3300005444 Bacteria 1114
14 Ga0070681_10169001 3300005458 Bacteria 2109
15 Ga0070679_100482195 3300005530 Bacteria 1184
16 Ga0070704_100280684 3300005549 Bacteria 1380
17 Ga0068861_100764976 3300005719 Bacteria 903
18 Ga0081455_10025130 3300005937 Bacteria 5503
19 Ga0081538_10080409 3300005981 Bacteria 1739
20 Ga0070717_10076740 3300006028 Bacteria 2797
21 Ga0075432_10009294 3300006058 Bacteria 3347
22 Ga0070712_100851783 3300006175 Bacteria 784
23 Ga0075428_100402573 3300006844 Bacteria 1467
24 Ga0075428_100432908 3300006844 Bacteria 1409
25 Ga0075430_100083445 3300006846 Bacteria 2677
26 Ga0075431_100122564 3300006847 Bacteria 2682
27 Ga0075431_100157226 3300006847 Bacteria 2338
28 Ga0075433_10352057 3300006852 Bacteria 1301
29 Ga0075434_100139409 3300006871 Bacteria 2444
30 Ga0075434_101809228 3300006871 Bacteria 617
31 Ga0075429_100416281 3300006880 Bacteria 1177
32 Ga0075436_100022874 3300006914 Bacteria 4293
33 Ga0075435_100226909 3300007076 Bacteria 1586
34 Ga0105240_10646786 3300009093 Unclassified 1159
35 Ga0111539_10479792 3300009094 Bacteria 1448
36 Ga0111539_10485781 3300009094 Bacteria 1438
37 Ga0111539_12268926 3300009094 Bacteria 630
38 Ga0105245_10016574 3300009098 Bacteria 6429
39 Ga0114129_10931991 3300009147 Bacteria 1098
40 Ga0114129_11023532 3300009147 Bacteria 1039
41 Ga0114129_11795491 3300009147 Bacteria 746
42 Ga0105242_10289877 3300009176 Bacteria 1490
43 Ga0105242_11401289 3300009176 Bacteria 726
44 Ga0105248_10136844 3300009177 Bacteria 2763
45 Ga0105249_10103681 3300009553 Bacteria 2679
46 Ga0105249_10191255 3300009553 Bacteria 1997
47 Ga0105239_11985441 3300010375 Bacteria 675
48 Ga0157369_10161084 3300013105 Bacteria 2368
49 Ga0157369_10401140 3300013105 Bacteria 1423
50 Ga0157372_10521424 3300013307 Bacteria 1385
51 Ga0157372_11436489 3300013307 Bacteria 795
52 Ga0163163_10888016 3300014325 Bacteria 955
53 Ga0157376_13115819 3300014969 Bacteria 502
54 Ga0163161_10817713 3300017792 Bacteria 784
55 Ga0206353_11557492 3300020082 Bacteria 542
56 Ga0213873_10001355 3300021358 Bacteria 4036
57 Ga0213876_10013123 3300021384 Bacteria 4403
58 Ga0213875_10198122 3300021388 Bacteria 945
59 Ga0207699_10203171 3300025906 Bacteria 1344
60 Ga0207705_10604890 3300025909 Bacteria 852
61 Ga0207707_10342315 3300025912 Bacteria 1289
62 Ga0207707_10453228 3300025912 Bacteria 1098
63 Ga0207695_11394784 3300025913 Unclassified 581
64 Ga0207652_10443475 3300025921 Bacteria 1170
65 Ga0207687_10232466 3300025927 Bacteria 1457
66 Ga0207700_10000882 3300025928 Bacteria 17265
67 Ga0207664_10121180 3300025929 Bacteria 2189
68 Ga0207664_10282447 3300025929 Bacteria 1457
69 Ga0207664_11050549 3300025929 Bacteria 729
70 Ga0207664_11608241 3300025929 Bacteria 572
71 Ga0207644_10402582 3300025931 Bacteria 1119
72 Ga0207644_10590124 3300025931 Unclassified 922
73 Ga0207711_10211689 3300025941 Archaea 1771
74 Ga0207712_10382874 3300025961 Bacteria 1178
75 Ga0207712_10779956 3300025961 Bacteria 839
76 Ga0207674_11940164 3300026116 Bacteria 554
77 Ga0207675_100154729 3300026118 Bacteria 2184
78 Ga0207675_100818959 3300026118 Unclassified 945
79 Ga0209966_1114590 3300027695 Bacteria 616
80 Ga0209998_10056575 3300027717 Bacteria 917
81 Ga0207428_10003447 3300027907 Bacteria 15358
82 Ga0265319_1037261 3300028563 Bacteria 1659
83 Ga0265336_10011442 3300028666 Bacteria 3016
84 Ga0265338_11124533 3300028800 Bacteria 528
85 Ga0265324_10007695 3300029957 Bacteria 4338
86 Ga0373948_0096502 3300034817 Bacteria 692
87 Ga0373933_0403148 3300035724 Unclassified 892
88 Ga0395898_0451257 3300037466 Bacteria 1225
89 Ga0395898_1849639 3300037466 Bacteria 524
90 Ga0436364_1218275 3300037853 Bacteria 9934
91 Ga0395901_0027691 3300038443 Bacteria 5827
92 Ga0436365_0319475 3300039437 Bacteria 2198
93 Ga0436365_0321006 3300039437 Bacteria 3844
94 Ga0436363_0646488 3300039450 Bacteria 649
95 Ga0436362_1015541 3300039453 Bacteria 5891
96 Ga0439448_0104599 3300042005 Bacteria 964
97 Ga0466969_0037225 3300044656 Bacteria 2455
98 Ga0466966_0040204 3300044684 Bacteria 3010
99 Ga0466966_0097950 3300044684 Bacteria 1816
100 Ga0466966_0130340 3300044684 Bacteria 1540
101 Ga0466966_0228564 3300044684 Bacteria 1123
102 Ga0466966_0469943 3300044684 Bacteria 756
103 Ga0466961_0015645 3300044693 Bacteria 4867
104 Ga0466961_0301424 3300044693 Bacteria 979
105 Ga0466963_0022185 3300044694 Bacteria 4018
106 Ga0466971_0160978 3300044719 Bacteria 1051
107 Ga0466971_0633335 3300044719 Bacteria 535
108 Ga0466968_0027986 3300044735 Bacteria 2322
109 Ga0466968_0090119 3300044735 Bacteria 1357
110 Ga0466968_0350233 3300044735 Bacteria 717
111 Ga0466970_0094924 3300044765 Bacteria 1621
112 Ga0466957_0032709 3300044842 Bacteria 3116
113 Ga0466957_0037525 3300044842 Bacteria 2918
114 Ga0466957_0610163 3300044842 Bacteria 764
115 Ga0466960_0052803 3300044901 Bacteria 1968
116 Ga0466960_0059610 3300044901 Bacteria 1868
117 Ga0466959_0012878 3300045049 Bacteria 6054
118 Ga0466959_0053001 3300045049 Bacteria 2968
119 Ga0466959_0536920 3300045049 Bacteria 789
120 Ga0451576_0741307 3300045051 Bacteria 1032
121 Ga0466958_0051746 3300045836 Bacteria 2487
122 Ga0466958_0134184 3300045836 Bacteria 1556
123 Ga0466958_0264171 3300045836 Bacteria 1102
124 Ga0466958_0538910 3300045836 Bacteria 758
125 Ga0466958_0661307 3300045836 Bacteria 680
126 Ga0466967_0017864 3300045976 Bacteria 5650
127 Ga0466967_1141842 3300045976 Bacteria 776
128 Ga0495592_0495632 3300046454 Unclassified 759
129 Ga0495651_0259481 3300046462 Unclassified 1183
130 Ga0495651_0940669 3300046462 Unclassified 527
131 Ga0495618_0257742 3300046514 Unclassified 1093
132 Ga0495667_0130542 3300046559 Bacteria 1621
133 Ga0495634_0119528 3300046642 Bacteria 1688
134 Ga0495657_0079794 3300046675 Bacteria 2119
135 Ga0495657_0364360 3300046675 Unclassified 854
136 Ga0495600_0423787 3300046809 Unclassified 826
137 Ga0495674_0528412 3300047319 Bacteria 941
138 Ga0496102_0462842 3300048905 Bacteria 1189
139 Ga0496102_1770672 3300048905 Bacteria 535
140 Ga0496109_0674383 3300048912 Bacteria 971
141 Ga0496110_1580620 3300048913 Bacteria 566
142 Ga0496114_0665588 3300048917 Bacteria 915
143 Ga0501068_0445672 3300049584 Bacteria 837
144 nmdc:mga06z11_846588_c1 3300050494 Bacteria 557
145 nmdc:mga05p37_1300802_c1 3300050507 Unclassified 741
146 nmdc:mga05p37_221535_c1 3300050507 Bacteria 2283
147 nmdc:mga09592_495198_c1 3300050508 Bacteria 1052
148 nmdc:mga0qj67_253246_c1 3300050509 Bacteria 1428
149 nmdc:mga06r32_1119662_c1 3300050510 Bacteria 736
150 nmdc:mga06r32_138447_c1 3300050510 Bacteria 2409
151 nmdc:mga06r32_34811_c1 3300050510 Bacteria 4751
152 nmdc:mga08y16_1628489_c1 3300050511 Bacteria 603
153 nmdc:mga08y16_17548_c1 3300050511 Bacteria 7538
154 nmdc:mga08y16_1857550_c1 3300050511 Bacteria 554
155 nmdc:mga0n895_210062_c1 3300050512 Bacteria 1977
156 nmdc:mga0n895_27552_c1 3300050512 Bacteria 5400
157 nmdc:mga0n895_610515_c1 3300050512 Bacteria 1092
158 nmdc:mga0rr50_205110_c1 3300050513 Bacteria 1622
159 nmdc:mga0rr50_28668_c1 3300050513 Bacteria 3917
160 nmdc:mga08x19_12941_c1 3300050514 Bacteria 5037
161 nmdc:mga08x19_972175_c1 3300050514 Bacteria 603
162 nmdc:mga0a205_126935_c1 3300050515 Bacteria 2450
163 nmdc:mga0a205_2605_c1 3300050515 Bacteria 15936
164 Ga0495655_0142979 3300053083 Bacteria 746
165 Ga0466962_0236189 3300061719 Bacteria 897
166 Ga0466962_0442914 3300061719 Bacteria 654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10931991 Ga0114129_109319911 106
2 3300050507 nmdc:mga05p37_1300802_c1 nmdc:mga05p37_1300802_c1_242_568 106
3 3300005327 Ga0070658_10717744 Ga0070658_107177442 108
4 3300005336 Ga0070680_100169283 Ga0070680_1001692833 108
5 3300005458 Ga0070681_10169001 Ga0070681_101690012 108
6 3300005530 Ga0070679_100482195 Ga0070679_1004821953 108
7 3300013105 Ga0157369_10401140 Ga0157369_104011402 108
8 3300020082 Ga0206353_11557492 Ga0206353_115574922 108
9 3300025909 Ga0207705_10604890 Ga0207705_106048902 108
10 3300025912 Ga0207707_10342315 Ga0207707_103423153 108
11 3300025921 Ga0207652_10443475 Ga0207652_104434753 108
12 3300005355 Ga0070671_100122890 Ga0070671_1001228902 109
13 3300005355 Ga0070671_101430989 Ga0070671_1014309891 109
14 3300009093 Ga0105240_10646786 Ga0105240_106467862 109
15 3300009176 Ga0105242_11401289 Ga0105242_114012891 109
16 3300009177 Ga0105248_10136844 Ga0105248_101368443 109
17 3300025913 Ga0207695_11394784 Ga0207695_113947841 109
18 3300025931 Ga0207644_10402582 Ga0207644_104025822 109
19 3300025931 Ga0207644_10590124 Ga0207644_105901242 109
20 3300025941 Ga0207711_10211689 Ga0207711_102116892 109
21 3300028563 Ga0265319_1037261 Ga0265319_10372613 109
22 3300028666 Ga0265336_10011442 Ga0265336_100114425 109
23 3300028800 Ga0265338_11124533 Ga0265338_111245331 109
24 3300029957 Ga0265324_10007695 Ga0265324_100076952 109
25 3300035724 Ga0373933_0403148 Ga0373933_0403148_86_415 109
26 3300039450 Ga0436363_0646488 Ga0436363_0646488_278_607 109
27 3300044842 Ga0466957_0610163 Ga0466957_0610163_381_710 109
28 3300046454 Ga0495592_0495632 Ga0495592_0495632_357_686 109
29 3300046462 Ga0495651_0259481 Ga0495651_0259481_825_1154 109
30 3300046514 Ga0495618_0257742 Ga0495618_0257742_378_707 109
31 3300046559 Ga0495667_0130542 Ga0495667_0130542_98_427 109
32 3300046642 Ga0495634_0119528 Ga0495634_0119528_1106_1435 109
33 3300046809 Ga0495600_0423787 Ga0495600_0423787_16_345 109
34 3300001990 JGI24737J22298_10042285 JGI24737J22298_100422852 110
35 3300005347 Ga0070668_100357722 Ga0070668_1003577222 110
36 3300005434 Ga0070709_11648469 Ga0070709_116484691 110
37 3300005435 Ga0070714_100311188 Ga0070714_1003111882 110
38 3300005435 Ga0070714_100967683 Ga0070714_1009676832 110
39 3300005435 Ga0070714_100990769 Ga0070714_1009907692 110
40 3300005435 Ga0070714_102161809 Ga0070714_1021618091 110
41 3300005437 Ga0070710_10357172 Ga0070710_103571721 110
42 3300005444 Ga0070694_100371075 Ga0070694_1003710752 110
43 3300005549 Ga0070704_100280684 Ga0070704_1002806842 110
44 3300005719 Ga0068861_100764976 Ga0068861_1007649762 110
45 3300005937 Ga0081455_10025130 Ga0081455_100251302 110
46 3300005981 Ga0081538_10080409 Ga0081538_100804092 110
47 3300006028 Ga0070717_10076740 Ga0070717_100767404 110
48 3300006058 Ga0075432_10009294 Ga0075432_100092942 110
49 3300006175 Ga0070712_100851783 Ga0070712_1008517832 110
50 3300006844 Ga0075428_100402573 Ga0075428_1004025733 110
51 3300006844 Ga0075428_100432908 Ga0075428_1004329083 110
52 3300006846 Ga0075430_100083445 Ga0075430_1000834454 110
53 3300006847 Ga0075431_100122564 Ga0075431_1001225643 110
54 3300006847 Ga0075431_100157226 Ga0075431_1001572263 110
55 3300006852 Ga0075433_10352057 Ga0075433_103520572 110
56 3300006871 Ga0075434_100139409 Ga0075434_1001394092 110
57 3300006871 Ga0075434_101809228 Ga0075434_1018092282 110
58 3300006880 Ga0075429_100416281 Ga0075429_1004162812 110
59 3300006914 Ga0075436_100022874 Ga0075436_1000228745 110
60 3300007076 Ga0075435_100226909 Ga0075435_1002269092 110
61 3300009094 Ga0111539_10479792 Ga0111539_104797921 110
62 3300009094 Ga0111539_10485781 Ga0111539_104857813 110
63 3300009094 Ga0111539_12268926 Ga0111539_122689262 110
64 3300009098 Ga0105245_10016574 Ga0105245_100165744 110
65 3300009147 Ga0114129_11023532 Ga0114129_110235322 110
66 3300009147 Ga0114129_11795491 Ga0114129_117954912 110
67 3300009176 Ga0105242_10289877 Ga0105242_102898773 110
68 3300009553 Ga0105249_10103681 Ga0105249_101036811 110
69 3300009553 Ga0105249_10191255 Ga0105249_101912552 110
70 3300010375 Ga0105239_11985441 Ga0105239_119854411 110
71 3300013105 Ga0157369_10161084 Ga0157369_101610842 110
72 3300013307 Ga0157372_10521424 Ga0157372_105214242 110
73 3300013307 Ga0157372_11436489 Ga0157372_114364892 110
74 3300014325 Ga0163163_10888016 Ga0163163_108880162 110
75 3300014969 Ga0157376_13115819 Ga0157376_131158192 110
76 3300017792 Ga0163161_10817713 Ga0163161_108177132 110
77 3300021358 Ga0213873_10001355 Ga0213873_100013553 110
78 3300021384 Ga0213876_10013123 Ga0213876_100131233 110
79 3300021388 Ga0213875_10198122 Ga0213875_101981222 110
80 3300025906 Ga0207699_10203171 Ga0207699_102031713 110
81 3300025912 Ga0207707_10453228 Ga0207707_104532281 110
82 3300025927 Ga0207687_10232466 Ga0207687_102324663 110
83 3300025928 Ga0207700_10000882 Ga0207700_1000088216 110
84 3300025929 Ga0207664_10121180 Ga0207664_101211803 110
85 3300025929 Ga0207664_10282447 Ga0207664_102824472 110
86 3300025929 Ga0207664_11050549 Ga0207664_110505492 110
87 3300025929 Ga0207664_11608241 Ga0207664_116082411 110
88 3300025961 Ga0207712_10382874 Ga0207712_103828742 110
89 3300025961 Ga0207712_10779956 Ga0207712_107799562 110
90 3300026116 Ga0207674_11940164 Ga0207674_119401642 110
91 3300026118 Ga0207675_100154729 Ga0207675_1001547293 110
92 3300026118 Ga0207675_100818959 Ga0207675_1008189593 110
93 3300027695 Ga0209966_1114590 Ga0209966_11145902 110
94 3300027717 Ga0209998_10056575 Ga0209998_100565752 110
95 3300027907 Ga0207428_10003447 Ga0207428_1000344712 110
96 3300034817 Ga0373948_0096502 Ga0373948_0096502_308_643 110
97 3300037466 Ga0395898_0451257 Ga0395898_0451257_797_1132 110
98 3300037466 Ga0395898_1849639 Ga0395898_1849639_122_454 110
99 3300037853 Ga0436364_1218275 Ga0436364_1218275_9084_9422 110
100 3300038443 Ga0395901_0027691 Ga0395901_0027691_4846_5223 110
101 3300039437 Ga0436365_0319475 Ga0436365_0319475_1729_2070 110
102 3300039437 Ga0436365_0321006 Ga0436365_0321006_213_548 110
103 3300039453 Ga0436362_1015541 Ga0436362_1015541_2208_2543 110
104 3300042005 Ga0439448_0104599 Ga0439448_0104599_275_610 110
105 3300044656 Ga0466969_0037225 Ga0466969_0037225_1227_1559 110
106 3300044684 Ga0466966_0040204 Ga0466966_0040204_2063_2395 110
107 3300044684 Ga0466966_0097950 Ga0466966_0097950_124_459 110
108 3300044684 Ga0466966_0130340 Ga0466966_0130340_433_765 110
109 3300044684 Ga0466966_0228564 Ga0466966_0228564_23_358 110
110 3300044684 Ga0466966_0469943 Ga0466966_0469943_71_406 110
111 3300044693 Ga0466961_0015645 Ga0466961_0015645_4498_4830 110
112 3300044693 Ga0466961_0301424 Ga0466961_0301424_473_808 110
113 3300044694 Ga0466963_0022185 Ga0466963_0022185_3359_3694 110
114 3300044719 Ga0466971_0160978 Ga0466971_0160978_61_396 110
115 3300044719 Ga0466971_0633335 Ga0466971_0633335_54_389 110
116 3300044735 Ga0466968_0027986 Ga0466968_0027986_1810_2145 110
117 3300044735 Ga0466968_0090119 Ga0466968_0090119_86_481 110
118 3300044735 Ga0466968_0350233 Ga0466968_0350233_77_412 110
119 3300044765 Ga0466970_0094924 Ga0466970_0094924_476_871 110
120 3300044842 Ga0466957_0032709 Ga0466957_0032709_437_772 110
121 3300044842 Ga0466957_0037525 Ga0466957_0037525_1052_1387 110
122 3300044901 Ga0466960_0052803 Ga0466960_0052803_366_698 110
123 3300044901 Ga0466960_0059610 Ga0466960_0059610_1036_1368 110
124 3300045049 Ga0466959_0012878 Ga0466959_0012878_326_661 110
125 3300045049 Ga0466959_0053001 Ga0466959_0053001_1737_2069 110
126 3300045049 Ga0466959_0536920 Ga0466959_0536920_406_738 110
127 3300045051 Ga0451576_0741307 Ga0451576_0741307_400_735 110
128 3300045836 Ga0466958_0051746 Ga0466958_0051746_1934_2269 110
129 3300045836 Ga0466958_0134184 Ga0466958_0134184_629_964 110
130 3300045836 Ga0466958_0264171 Ga0466958_0264171_220_555 110
131 3300045836 Ga0466958_0538910 Ga0466958_0538910_66_401 110
132 3300045836 Ga0466958_0661307 Ga0466958_0661307_56_391 110
133 3300045976 Ga0466967_0017864 Ga0466967_0017864_2902_3234 110
134 3300045976 Ga0466967_1141842 Ga0466967_1141842_261_593 110
135 3300046462 Ga0495651_0940669 Ga0495651_0940669_146_487 110
136 3300046675 Ga0495657_0079794 Ga0495657_0079794_533_871 110
137 3300046675 Ga0495657_0364360 Ga0495657_0364360_207_548 110
138 3300047319 Ga0495674_0528412 Ga0495674_0528412_126_461 110
139 3300048905 Ga0496102_0462842 Ga0496102_0462842_558_890 110
140 3300048905 Ga0496102_1770672 Ga0496102_1770672_23_355 110
141 3300048912 Ga0496109_0674383 Ga0496109_0674383_106_441 110
142 3300048913 Ga0496110_1580620 Ga0496110_1580620_182_514 110
143 3300048917 Ga0496114_0665588 Ga0496114_0665588_180_512 110
144 3300049584 Ga0501068_0445672 Ga0501068_0445672_367_699 110
145 3300050494 nmdc:mga06z11_846588_c1 nmdc:mga06z11_846588_c1_84_431 110
146 3300050507 nmdc:mga05p37_221535_c1 nmdc:mga05p37_221535_c1_1557_1892 110
147 3300050508 nmdc:mga09592_495198_c1 nmdc:mga09592_495198_c1_361_696 110
148 3300050509 nmdc:mga0qj67_253246_c1 nmdc:mga0qj67_253246_c1_418_753 110
149 3300050510 nmdc:mga06r32_1119662_c1 nmdc:mga06r32_1119662_c1_115_450 110
150 3300050510 nmdc:mga06r32_138447_c1 nmdc:mga06r32_138447_c1_1023_1358 110
151 3300050510 nmdc:mga06r32_34811_c1 nmdc:mga06r32_34811_c1_1377_1712 110
152 3300050511 nmdc:mga08y16_1628489_c1 nmdc:mga08y16_1628489_c1_94_429 110
153 3300050511 nmdc:mga08y16_17548_c1 nmdc:mga08y16_17548_c1_2787_3122 110
154 3300050511 nmdc:mga08y16_1857550_c1 nmdc:mga08y16_1857550_c1_23_355 110
155 3300050512 nmdc:mga0n895_210062_c1 nmdc:mga0n895_210062_c1_210_542 110
156 3300050512 nmdc:mga0n895_27552_c1 nmdc:mga0n895_27552_c1_2271_2606 110
157 3300050512 nmdc:mga0n895_610515_c1 nmdc:mga0n895_610515_c1_713_1045 110
158 3300050513 nmdc:mga0rr50_205110_c1 nmdc:mga0rr50_205110_c1_723_1055 110
159 3300050513 nmdc:mga0rr50_28668_c1 nmdc:mga0rr50_28668_c1_964_1299 110
160 3300050514 nmdc:mga08x19_12941_c1 nmdc:mga08x19_12941_c1_2808_3143 110
161 3300050514 nmdc:mga08x19_972175_c1 nmdc:mga08x19_972175_c1_220_552 110
162 3300050515 nmdc:mga0a205_126935_c1 nmdc:mga0a205_126935_c1_1181_1513 110
163 3300050515 nmdc:mga0a205_2605_c1 nmdc:mga0a205_2605_c1_12078_12413 110
164 3300053083 Ga0495655_0142979 Ga0495655_0142979_57_389 110
165 3300061719 Ga0466962_0236189 Ga0466962_0236189_75_410 110
166 3300061719 Ga0466962_0442914 Ga0466962_0442914_148_480 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04993

TfoX_N

TfoX N-terminal domain

33

124

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g1i-assembly1.cif.gz_A structure of the prgh periplasmic domain 0.7263 4 34
6q15-assembly1.cif.gz_V structure of the salmonella spi-1 injectisome needle complex 0.7041 4 34
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6717 7 107
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.641 9 99
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6286 7 107
ID Description Score Start End Superfamily
4n06B01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2;CRISPR-associated endonuclease Cas1, N-terminal domain 0.7307 19 43 3.100.10.20
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.675 5 107 3.90.1150.30
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6472 1 107 3.90.1150.30
3h9xA00 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.647 9 99 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6397 5 107 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A7V9DNC1-F1-model_v4 TfoX/Sxy family protein 0.9822 1 109
AF-A0A538DXJ4-F1-model_v4 Dienelactone hydrolase family protein 0.9805 1 109 GO:0016787
AF-A0A7I7WJ16-F1-model_v4 TfoX N-terminal domain-containing protein 0.9804 2 109
AF-A0A1C4XWA8-F1-model_v4 TfoX N-terminal domain-containing protein 0.9795 1 106
AF-I4EQR7-F1-model_v4 TfoX N-terminal domain-containing protein 0.9791 1 107

Feature Viewer

pLDDT pTM Quality
95.44 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map