F248457

General Info

Members Datasets Scaffolds Average Seq Length
166 102 166 134

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10000069|Ga0213872_1000006939
Length 135
Sequence MKVQDESKPYDTINVTPMLDLAYVLLVIFIVMTTASVQGLKIDLPKPSNKPNKTEHKEMRIVQIQPDGSLLLNGAAISLEELESRLGAIHAREPDMPMVIKGDPQAHYDQVVAIIDLAARLNIANVGLVTARIGT

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
10 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
13 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
14 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
17 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
25 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
30 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
31 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
45 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
46 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
47 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
59 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
60 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
61 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
62 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
63 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
64 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
65 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
66 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
67 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
68 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
69 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
70 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
71 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
74 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
75 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
76 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
77 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
78 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
79 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
80 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
81 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
82 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
83 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
84 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
87 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
88 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
89 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
90 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
91 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
96 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
97 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
98 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
99 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
100 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
101 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
102 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.82
Nodule 0
Rhizoplane 9.04
Rhizosphere 67.47
Stem 0
Stem Tuber 0
Unclassified 18.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10218213 3300003323 Bacteria 2594
2 Ga0055540_1016499 3300003792 Bacteria 2100
3 Ga0070683_100708376 3300005329 Bacteria 964
4 Ga0070667_101214361 3300005367 Bacteria 706
5 Ga0070662_100162497 3300005457 Bacteria 1748
6 Ga0070665_100001863 3300005548 Bacteria 23941
7 Ga0070665_100097048 3300005548 Bacteria 2952
8 Ga0068855_100000179 3300005563 Bacteria 81168
9 Ga0068856_100042551 3300005614 Bacteria 4469
10 Ga0068852_100388790 3300005616 Bacteria 1370
11 Ga0068862_100010193 3300005844 Bacteria 7755
12 Ga0075432_10327217 3300006058 Bacteria 643
13 Ga0097621_100259795 3300006237 Bacteria 1523
14 Ga0068865_100577361 3300006881 Bacteria 947
15 Ga0105240_10003795 3300009093 Bacteria 23341
16 Ga0105240_10025102 3300009093 Bacteria 7841
17 Ga0105240_10061748 3300009093 Bacteria 4669
18 Ga0111539_10490175 3300009094 Bacteria 1431
19 Ga0105245_10724923 3300009098 Bacteria 1029
20 Ga0105243_10088484 3300009148 Bacteria 2544
21 Ga0105237_10043583 3300009545 Unclassified 4519
22 Ga0105237_10085012 3300009545 Bacteria 3153
23 Ga0105237_10615711 3300009545 Unclassified 1093
24 Ga0105238_10058382 3300009551 Bacteria 3868
25 Ga0105238_10544155 3300009551 Bacteria 1165
26 Ga0105249_11266340 3300009553 Bacteria 809
27 Ga0105239_10725765 3300010375 Unclassified 1137
28 Ga0105239_10782951 3300010375 Bacteria 1092
29 Ga0157378_10367812 3300013297 Bacteria 1409
30 Ga0157372_10188819 3300013307 Unclassified 2386
31 Ga0163163_11571053 3300014325 Bacteria 719
32 Ga0157379_10224984 3300014968 Bacteria 1700
33 Ga0157376_10896177 3300014969 Bacteria 905
34 Ga0163161_10058630 3300017792 Bacteria 2798
35 Ga0213872_10000009 3300021361 Bacteria 221470
36 Ga0213872_10000069 3300021361 Bacteria 91692
37 Ga0213872_10000203 3300021361 Bacteria 52816
38 Ga0213872_10000765 3300021361 Bacteria 23597
39 Ga0213872_10001146 3300021361 Bacteria 18043
40 Ga0213874_10119135 3300021377 Bacteria 895
41 Ga0213871_10025529 3300021441 Bacteria 1505
42 Ga0209051_1000912 3300025303 Bacteria 29411
43 Ga0209051_1003078 3300025303 Bacteria 11257
44 Ga0207695_10009733 3300025913 Bacteria 11831
45 Ga0207695_10623317 3300025913 Bacteria 960
46 Ga0207695_10637187 3300025913 Unclassified 947
47 Ga0207694_10201714 3300025924 Bacteria 1619
48 Ga0207694_11029183 3300025924 Bacteria 697
49 Ga0207709_10138003 3300025935 Bacteria 1672
50 Ga0207665_11162772 3300025939 Bacteria 615
51 Ga0207661_10170523 3300025944 Bacteria 1894
52 Ga0207667_10022528 3300025949 Bacteria 6955
53 Ga0207698_10609236 3300026142 Bacteria 1077
54 Ga0268266_10001164 3300028379 Bacteria 32544
55 Ga0268266_10126260 3300028379 Bacteria 2283
56 Ga0268265_10169257 3300028380 Bacteria 1865
57 Ga0265334_10001795 3300028573 Bacteria 10239
58 Ga0265336_10000036 3300028666 Bacteria 154609
59 Ga0307515_10000022 3300028794 Bacteria 404064
60 Ga0307515_10002830 3300028794 Bacteria 36919
61 Ga0307515_10009456 3300028794 Bacteria 18838
62 Ga0307515_10190496 3300028794 Bacteria 1962
63 Ga0265338_10083358 3300028800 Bacteria 2674
64 Ga0265324_10002076 3300029957 Bacteria 10607
65 Ga0265328_10000002 3300031239 Bacteria 275819
66 Ga0265328_10005707 3300031239 Bacteria 5317
67 Ga0265328_10016200 3300031239 Bacteria 2904
68 Ga0265328_10091207 3300031239 Bacteria 1126
69 Ga0265328_10275052 3300031239 Bacteria 647
70 Ga0265328_10358514 3300031239 Bacteria 568
71 Ga0265320_10013817 3300031240 Bacteria 4628
72 Ga0265329_10243679 3300031242 Bacteria 598
73 Ga0265340_10432560 3300031247 Bacteria 580
74 Ga0265331_10005408 3300031250 Bacteria 7718
75 Ga0265331_10156061 3300031250 Bacteria 1035
76 Ga0265327_10000085 3300031251 Bacteria 203068
77 Ga0265327_10000283 3300031251 Bacteria 100296
78 Ga0265327_10000619 3300031251 Bacteria 58479
79 Ga0265327_10003587 3300031251 Bacteria 14654
80 Ga0265327_10038445 3300031251 Bacteria 2611
81 Ga0265327_10284020 3300031251 Bacteria 731
82 Ga0265316_10000201 3300031344 Bacteria 69415
83 Ga0265316_10139896 3300031344 Bacteria 1819
84 Ga0265316_10727857 3300031344 Bacteria 698
85 Ga0265316_10756498 3300031344 Bacteria 683
86 Ga0307513_10753930 3300031456 Bacteria 679
87 Ga0307509_10516038 3300031507 Bacteria 877
88 Ga0307508_10157273 3300031616 Bacteria 1877
89 Ga0265342_10318650 3300031712 Bacteria 815
90 Ga0307516_10001689 3300031730 Bacteria 30398
91 Ga0307510_10000004 3300033180 Bacteria 654130
92 Ga0307510_10360556 3300033180 Bacteria 902
93 Ga0395899_0205108 3300037312 Bacteria 1372
94 Ga0395899_0588168 3300037312 Bacteria 710
95 Ga0395900_0158807 3300037418 Bacteria 2307
96 Ga0395898_0516775 3300037466 Bacteria 1135
97 Ga0395898_0519962 3300037466 Bacteria 1131
98 Ga0395905_0000084 3300037471 Bacteria 158046
99 Ga0395905_0627680 3300037471 Bacteria 976
100 Ga0436360_0132784 3300039438 Bacteria 4208
101 Ga0436360_0404221 3300039438 Bacteria 609
102 Ga0436360_0568632 3300039438 Bacteria 1710
103 Ga0436361_0080480 3300039447 Bacteria 16890
104 Ga0436361_0108199 3300039447 Bacteria 59346
105 Ga0436361_0199503 3300039447 Bacteria 72236
106 Ga0436361_0329151 3300039447 Bacteria 4462
107 Ga0436361_0333719 3300039447 Bacteria 53264
108 Ga0436361_0399215 3300039447 Bacteria 3278
109 Ga0436361_0572581 3300039447 Bacteria 116104
110 Ga0436361_1126786 3300039447 Bacteria 5236
111 Ga0436363_0075544 3300039450 Bacteria 22085
112 Ga0436363_0297454 3300039450 Bacteria 920
113 Ga0451577_0494106 3300042876 Bacteria 1111
114 Ga0451576_0114530 3300045051 Bacteria 2807
115 Ga0495606_0340078 3300046507 Bacteria 800
116 Ga0495643_0344787 3300046522 Bacteria 668
117 Ga0495649_0070095 3300046694 Bacteria 1880
118 Ga0495687_041478 3300047443 Bacteria 2019
119 Ga0496102_0016211 3300048905 Bacteria 6512
120 Ga0496105_0382409 3300048908 Bacteria 1120
121 Ga0496107_0102119 3300048910 Bacteria 2103
122 Ga0496108_0008516 3300048911 Bacteria 8318
123 Ga0496108_0516225 3300048911 Bacteria 1043
124 Ga0496108_1439542 3300048911 Bacteria 575
125 Ga0496109_0377354 3300048912 Bacteria 1339
126 Ga0496109_0832005 3300048912 Bacteria 861
127 Ga0496110_0055035 3300048913 Bacteria 3501
128 Ga0496110_0372104 3300048913 Bacteria 1302
129 Ga0496110_0727982 3300048913 Bacteria 894
130 Ga0496114_0014896 3300048917 Bacteria 6249
131 Ga0496114_0028142 3300048917 Bacteria 4609
132 Ga0496115_0235984 3300048918 Bacteria 1508
133 Ga0496115_0825130 3300048918 Bacteria 720
134 Ga0496116_0019297 3300048919 Bacteria 5222
135 Ga0496117_0000580 3300048920 Bacteria 60193
136 Ga0496118_0000250 3300048921 Bacteria 95160
137 Ga0496119_0000385 3300048922 Bacteria 60896
138 Ga0496119_0000872 3300048922 Bacteria 39623
139 Ga0496119_0051377 3300048922 Bacteria 2534
140 Ga0496120_0000169 3300048923 Bacteria 110523
141 Ga0496120_0024864 3300048923 Bacteria 3727
142 Ga0496121_0016236 3300048924 Bacteria 7704
143 Ga0496121_0073914 3300048924 Bacteria 2729
144 Ga0496124_0055206 3300048927 Bacteria 3358
145 Ga0496124_0286879 3300048927 Bacteria 1197
146 Ga0496125_0019285 3300048928 Bacteria 6439
147 Ga0496125_0234833 3300048928 Bacteria 1169
148 Ga0496125_0457900 3300048928 Bacteria 729
149 Ga0496126_0074905 3300048929 Bacteria 3005
150 Ga0496126_0343814 3300048929 Bacteria 1221
151 Ga0501300_003017 3300049523 Bacteria 2512
152 Ga0501033_0001146 3300049570 Bacteria 23949
153 Ga0501034_0301352 3300049571 Bacteria 1539
154 Ga0501043_0075181 3300049579 Bacteria 2654
155 Ga0501046_0002875 3300049580 Bacteria 15954
156 Ga0501047_0198172 3300049581 Bacteria 1869
157 Ga0501232_035641 3300049757 Bacteria 711
158 Ga0501280_000170 3300049776 Bacteria 16845
159 Ga0501282_000279 3300049778 Bacteria 6211
160 Ga0501044_0006207 3300049823 Bacteria 13208
161 Ga0501044_0014826 3300049823 Bacteria 8402
162 Ga0500597_184934 3300053120 Bacteria 882
163 Ga0500561_0088425 3300053137 Bacteria 913
164 Ga0500637_0063841 3300053178 Bacteria 2112
165 Ga0500637_0106638 3300053178 Bacteria 1625
166 Ga0500611_137891 3300053727 Bacteria 662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005329 Ga0070683_100708376 Ga0070683_1007083762 133
2 3300005367 Ga0070667_101214361 Ga0070667_1012143612 133
3 3300005457 Ga0070662_100162497 Ga0070662_1001624972 133
4 3300005548 Ga0070665_100001863 Ga0070665_1000018638 133
5 3300005548 Ga0070665_100097048 Ga0070665_1000970483 133
6 3300005563 Ga0068855_100000179 Ga0068855_10000017956 133
7 3300005614 Ga0068856_100042551 Ga0068856_1000425514 133
8 3300005844 Ga0068862_100010193 Ga0068862_1000101935 133
9 3300006058 Ga0075432_10327217 Ga0075432_103272172 133
10 3300006237 Ga0097621_100259795 Ga0097621_1002597953 133
11 3300006881 Ga0068865_100577361 Ga0068865_1005773612 133
12 3300009093 Ga0105240_10003795 Ga0105240_100037954 133
13 3300009093 Ga0105240_10025102 Ga0105240_100251021 133
14 3300009093 Ga0105240_10061748 Ga0105240_100617484 133
15 3300009094 Ga0111539_10490175 Ga0111539_104901753 133
16 3300009545 Ga0105237_10043583 Ga0105237_100435832 133
17 3300009545 Ga0105237_10615711 Ga0105237_106157112 133
18 3300009551 Ga0105238_10058382 Ga0105238_100583824 133
19 3300009551 Ga0105238_10544155 Ga0105238_105441553 133
20 3300009553 Ga0105249_11266340 Ga0105249_112663401 133
21 3300010375 Ga0105239_10725765 Ga0105239_107257652 133
22 3300010375 Ga0105239_10782951 Ga0105239_107829512 133
23 3300013297 Ga0157378_10367812 Ga0157378_103678122 133
24 3300013307 Ga0157372_10188819 Ga0157372_101888193 133
25 3300014325 Ga0163163_11571053 Ga0163163_115710532 133
26 3300014968 Ga0157379_10224984 Ga0157379_102249843 133
27 3300014969 Ga0157376_10896177 Ga0157376_108961771 133
28 3300017792 Ga0163161_10058630 Ga0163161_100586302 133
29 3300021361 Ga0213872_10000009 Ga0213872_10000009184 133
30 3300021361 Ga0213872_10000069 Ga0213872_1000006939 133
31 3300021361 Ga0213872_10000203 Ga0213872_1000020325 133
32 3300021361 Ga0213872_10000765 Ga0213872_100007654 133
33 3300021361 Ga0213872_10001146 Ga0213872_100011463 133
34 3300021377 Ga0213874_10119135 Ga0213874_101191351 133
35 3300021441 Ga0213871_10025529 Ga0213871_100255292 133
36 3300025913 Ga0207695_10009733 Ga0207695_100097334 133
37 3300025913 Ga0207695_10623317 Ga0207695_106233172 133
38 3300025913 Ga0207695_10637187 Ga0207695_106371872 133
39 3300025924 Ga0207694_10201714 Ga0207694_102017142 133
40 3300025924 Ga0207694_11029183 Ga0207694_110291832 133
41 3300025939 Ga0207665_11162772 Ga0207665_111627721 133
42 3300025944 Ga0207661_10170523 Ga0207661_101705233 133
43 3300025949 Ga0207667_10022528 Ga0207667_100225283 133
44 3300028379 Ga0268266_10001164 Ga0268266_100011647 133
45 3300028379 Ga0268266_10126260 Ga0268266_101262603 133
46 3300028380 Ga0268265_10169257 Ga0268265_101692573 133
47 3300028573 Ga0265334_10001795 Ga0265334_1000179511 133
48 3300028666 Ga0265336_10000036 Ga0265336_1000003688 133
49 3300028794 Ga0307515_10000022 Ga0307515_10000022351 133
50 3300028794 Ga0307515_10009456 Ga0307515_1000945611 133
51 3300028794 Ga0307515_10190496 Ga0307515_101904963 133
52 3300028800 Ga0265338_10083358 Ga0265338_100833584 133
53 3300029957 Ga0265324_10002076 Ga0265324_1000207612 133
54 3300031239 Ga0265328_10000002 Ga0265328_1000000245 133
55 3300031239 Ga0265328_10005707 Ga0265328_100057073 133
56 3300031239 Ga0265328_10016200 Ga0265328_100162003 133
57 3300031239 Ga0265328_10091207 Ga0265328_100912072 133
58 3300031239 Ga0265328_10275052 Ga0265328_102750521 133
59 3300031239 Ga0265328_10358514 Ga0265328_103585141 133
60 3300031240 Ga0265320_10013817 Ga0265320_100138174 133
61 3300031242 Ga0265329_10243679 Ga0265329_102436791 133
62 3300031247 Ga0265340_10432560 Ga0265340_104325602 133
63 3300031250 Ga0265331_10005408 Ga0265331_100054083 133
64 3300031250 Ga0265331_10156061 Ga0265331_101560612 133
65 3300031251 Ga0265327_10000085 Ga0265327_1000008527 133
66 3300031251 Ga0265327_10000283 Ga0265327_1000028324 133
67 3300031251 Ga0265327_10000619 Ga0265327_1000061910 133
68 3300031251 Ga0265327_10003587 Ga0265327_100035875 133
69 3300031251 Ga0265327_10038445 Ga0265327_100384453 133
70 3300031251 Ga0265327_10284020 Ga0265327_102840202 133
71 3300031344 Ga0265316_10000201 Ga0265316_1000020144 133
72 3300031344 Ga0265316_10139896 Ga0265316_101398962 133
73 3300031344 Ga0265316_10727857 Ga0265316_107278572 133
74 3300031344 Ga0265316_10756498 Ga0265316_107564982 133
75 3300031456 Ga0307513_10753930 Ga0307513_107539302 133
76 3300031616 Ga0307508_10157273 Ga0307508_101572733 133
77 3300031712 Ga0265342_10318650 Ga0265342_103186502 133
78 3300033180 Ga0307510_10000004 Ga0307510_10000004457 133
79 3300033180 Ga0307510_10360556 Ga0307510_103605562 133
80 3300037312 Ga0395899_0205108 Ga0395899_0205108_202_609 133
81 3300037312 Ga0395899_0588168 Ga0395899_0588168_177_584 133
82 3300037418 Ga0395900_0158807 Ga0395900_0158807_1755_2162 133
83 3300037466 Ga0395898_0516775 Ga0395898_0516775_580_987 133
84 3300037466 Ga0395898_0519962 Ga0395898_0519962_195_602 133
85 3300037471 Ga0395905_0000084 Ga0395905_0000084_85214_85615 133
86 3300039438 Ga0436360_0132784 Ga0436360_0132784_139_540 133
87 3300039438 Ga0436360_0404221 Ga0436360_0404221_109_510 133
88 3300039438 Ga0436360_0568632 Ga0436360_0568632_528_929 133
89 3300039447 Ga0436361_0080480 Ga0436361_0080480_14009_14416 133
90 3300039447 Ga0436361_0108199 Ga0436361_0108199_51551_51958 133
91 3300039447 Ga0436361_0199503 Ga0436361_0199503_6487_6888 133
92 3300039447 Ga0436361_0329151 Ga0436361_0329151_2822_3223 133
93 3300039447 Ga0436361_0333719 Ga0436361_0333719_25898_26305 133
94 3300039447 Ga0436361_0399215 Ga0436361_0399215_1751_2152 133
95 3300039447 Ga0436361_0572581 Ga0436361_0572581_6424_6825 133
96 3300039447 Ga0436361_1126786 Ga0436361_1126786_2284_2685 133
97 3300039450 Ga0436363_0075544 Ga0436363_0075544_5243_5644 133
98 3300039450 Ga0436363_0297454 Ga0436363_0297454_84_485 133
99 3300042876 Ga0451577_0494106 Ga0451577_0494106_118_519 133
100 3300045051 Ga0451576_0114530 Ga0451576_0114530_1470_1871 133
101 3300046507 Ga0495606_0340078 Ga0495606_0340078_201_602 133
102 3300046522 Ga0495643_0344787 Ga0495643_0344787_222_623 133
103 3300046694 Ga0495649_0070095 Ga0495649_0070095_1412_1813 133
104 3300047443 Ga0495687_041478 Ga0495687_041478_1358_1759 133
105 3300048905 Ga0496102_0016211 Ga0496102_0016211_6088_6489 133
106 3300048908 Ga0496105_0382409 Ga0496105_0382409_411_815 133
107 3300048910 Ga0496107_0102119 Ga0496107_0102119_155_559 133
108 3300048911 Ga0496108_0008516 Ga0496108_0008516_5342_5746 133
109 3300048911 Ga0496108_0516225 Ga0496108_0516225_443_847 133
110 3300048911 Ga0496108_1439542 Ga0496108_1439542_123_524 133
111 3300048912 Ga0496109_0377354 Ga0496109_0377354_518_919 133
112 3300048912 Ga0496109_0832005 Ga0496109_0832005_148_552 133
113 3300048913 Ga0496110_0055035 Ga0496110_0055035_1289_1693 133
114 3300048913 Ga0496110_0372104 Ga0496110_0372104_295_696 133
115 3300048913 Ga0496110_0727982 Ga0496110_0727982_121_522 133
116 3300048917 Ga0496114_0014896 Ga0496114_0014896_1045_1449 133
117 3300048917 Ga0496114_0028142 Ga0496114_0028142_2602_3006 133
118 3300048918 Ga0496115_0235984 Ga0496115_0235984_1009_1413 133
119 3300048918 Ga0496115_0825130 Ga0496115_0825130_160_564 133
120 3300048919 Ga0496116_0019297 Ga0496116_0019297_711_1112 133
121 3300048920 Ga0496117_0000580 Ga0496117_0000580_52128_52529 133
122 3300048921 Ga0496118_0000250 Ga0496118_0000250_44957_45358 133
123 3300048922 Ga0496119_0000385 Ga0496119_0000385_3928_4329 133
124 3300048922 Ga0496119_0000872 Ga0496119_0000872_37653_38054 133
125 3300048922 Ga0496119_0051377 Ga0496119_0051377_2041_2442 133
126 3300048923 Ga0496120_0000169 Ga0496120_0000169_46391_46792 133
127 3300048923 Ga0496120_0024864 Ga0496120_0024864_2146_2547 133
128 3300048924 Ga0496121_0016236 Ga0496121_0016236_2146_2547 133
129 3300048924 Ga0496121_0073914 Ga0496121_0073914_844_1245 133
130 3300048927 Ga0496124_0055206 Ga0496124_0055206_983_1384 133
131 3300048927 Ga0496124_0286879 Ga0496124_0286879_80_481 133
132 3300048928 Ga0496125_0019285 Ga0496125_0019285_2029_2430 133
133 3300048928 Ga0496125_0234833 Ga0496125_0234833_157_558 133
134 3300048928 Ga0496125_0457900 Ga0496125_0457900_218_619 133
135 3300048929 Ga0496126_0074905 Ga0496126_0074905_807_1208 133
136 3300048929 Ga0496126_0343814 Ga0496126_0343814_452_853 133
137 3300049523 Ga0501300_003017 Ga0501300_003017_986_1390 133
138 3300049570 Ga0501033_0001146 Ga0501033_0001146_22675_23079 133
139 3300049571 Ga0501034_0301352 Ga0501034_0301352_791_1192 133
140 3300049579 Ga0501043_0075181 Ga0501043_0075181_355_759 133
141 3300049580 Ga0501046_0002875 Ga0501046_0002875_8298_8702 133
142 3300049581 Ga0501047_0198172 Ga0501047_0198172_1210_1614 133
143 3300049757 Ga0501232_035641 Ga0501232_035641_205_606 133
144 3300049776 Ga0501280_000170 Ga0501280_000170_13711_14115 133
145 3300049778 Ga0501282_000279 Ga0501282_000279_1602_2006 133
146 3300049823 Ga0501044_0006207 Ga0501044_0006207_6342_6746 133
147 3300049823 Ga0501044_0014826 Ga0501044_0014826_3987_4391 133
148 3300053120 Ga0500597_184934 Ga0500597_184934_159_560 133
149 3300053137 Ga0500561_0088425 Ga0500561_0088425_83_484 133
150 3300053178 Ga0500637_0063841 Ga0500637_0063841_447_848 133
151 3300053178 Ga0500637_0106638 Ga0500637_0106638_228_629 133
152 3300053727 Ga0500611_137891 Ga0500611_137891_90_491 133
153 3300003323 rootH1_10218213 rootH1_102182132 135
154 3300003792 Ga0055540_1016499 Ga0055540_10164993 135
155 3300005616 Ga0068852_100388790 Ga0068852_1003887902 135
156 3300009098 Ga0105245_10724923 Ga0105245_107249232 135
157 3300009148 Ga0105243_10088484 Ga0105243_100884842 135
158 3300009545 Ga0105237_10085012 Ga0105237_100850122 135
159 3300025303 Ga0209051_1000912 Ga0209051_10009128 135
160 3300025303 Ga0209051_1003078 Ga0209051_10030784 135
161 3300025935 Ga0207709_10138003 Ga0207709_101380032 135
162 3300026142 Ga0207698_10609236 Ga0207698_106092362 135
163 3300028794 Ga0307515_10002830 Ga0307515_100028302 135
164 3300031507 Ga0307509_10516038 Ga0307509_105160382 135
165 3300031730 Ga0307516_10001689 Ga0307516_1000168925 135
166 3300037471 Ga0395905_0627680 Ga0395905_0627680_543_950 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

6

132

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dg3-assembly2.cif.gz_C lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.9034 84 130
6utq-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with cadmium 0.903 87 130
6utr-assembly1.cif.gz_A lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase in complex with copper 0.8933 84 130
5udx-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with zinc 0.8928 87 130
5udw-assembly1.cif.gz_B lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with nickel 0.8909 84 130
ID Description Score Start End Superfamily
af_Q8I2P2_468_838_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8738 97 130 3.40.50.620
4kuhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8251 98 132 3.40.50.720
2jwlB00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.8183 57 125 3.30.420.270
3cnoA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8022 97 130 3.40.50.300
1xnhA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7917 61 130 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A2D9BSU1-F1-model_v4 deleted 0.838 47 132
AF-A0A3M5P2T7-F1-model_v4 TonB system transport protein ExbD 0.8267 41 132 GO:0005886
GO:0015031
GO:0022857
AF-A0A2D9BSU1-F1-model_v4 deleted 0.8119 47 132
AF-A0A3D6A0Z2-F1-model_v4 deleted 0.8067 41 132
AF-A0A2E6TIC0-F1-model_v4 Uncharacterized protein 0.7934 42 134 GO:0005886
GO:0015031
GO:0022857

Feature Viewer

pLDDT pTM Quality
76.01 0.5 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map