F247520

General Info

Members Datasets Scaffolds Average Seq Length
166 102 166 110

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10043476|JGI25405J52794_100434762
Length 127
Sequence LPGQKPPSVMSAMLRGEVWWVNFDPSVGGEIRKQRPAIILSNDAANKYLNRVQVVPLTSNVGRLYPSEALVTLQGQQSKAMADQLTTVSKTRLISRIGRVSARDMQQVERAVRVQLGLSGAPHNASS

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
46 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
49 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
52 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
53 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
54 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
55 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
60 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
61 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
62 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
63 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
68 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
69 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
81 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
85 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
86 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
88 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
91 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
92 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
93 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
94 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
95 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
96 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.99
Metatranscriptomes 3.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.6
Nodule 0
Rhizoplane 3.01
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10043476 3300003911 Bacteria 953
2 Ga0070689_101768578 3300005340 Unclassified 563
3 Ga0070687_100009489 3300005343 Bacteria 4172
4 Ga0070661_100373109 3300005344 Unclassified 1123
5 Ga0070688_100907605 3300005365 Unclassified 695
6 Ga0070688_101766094 3300005365 Unclassified 507
7 Ga0070711_100246129 3300005439 Bacteria 1400
8 Ga0070700_101811031 3300005441 Bacteria 526
9 Ga0070694_100488268 3300005444 Unclassified 978
10 Ga0070694_100837006 3300005444 Unclassified 756
11 Ga0070685_10245711 3300005466 Unclassified 1183
12 Ga0070706_100133629 3300005467 Bacteria 2316
13 Ga0070698_100687810 3300005471 Unclassified 965
14 Ga0070686_100445496 3300005544 Unclassified 994
15 Ga0068855_100014837 3300005563 Bacteria 9382
16 Ga0068855_100418885 3300005563 Bacteria 1465
17 Ga0068854_100089735 3300005578 Bacteria 2285
18 Ga0068856_101029893 3300005614 Unclassified 841
19 Ga0068852_100026538 3300005616 Bacteria 4710
20 Ga0068861_100981814 3300005719 Bacteria 805
21 Ga0081455_10009197 3300005937 Bacteria 10182
22 Ga0081538_10074840 3300005981 Bacteria 1841
23 Ga0075427_10074449 3300006194 Unclassified 608
24 Ga0075428_100432248 3300006844 Unclassified 1410
25 Ga0075428_100506252 3300006844 Bacteria 1292
26 Ga0075428_100745788 3300006844 Bacteria 1042
27 Ga0075428_102272264 3300006844 Unclassified 559
28 Ga0075430_100477698 3300006846 Bacteria 1028
29 Ga0075430_101083583 3300006846 Unclassified 660
30 Ga0075431_100046711 3300006847 Bacteria 4465
31 Ga0075433_10054266 3300006852 Bacteria 3496
32 Ga0075433_10568941 3300006852 Bacteria 996
33 Ga0075434_100313633 3300006871 Unclassified 1589
34 Ga0075429_100179871 3300006880 Unclassified 1853
35 Ga0075429_101260825 3300006880 Unclassified 645
36 Ga0105240_10662124 3300009093 Unclassified 1143
37 Ga0111539_10080026 3300009094 Bacteria 3844
38 Ga0114129_10307160 3300009147 Bacteria 2112
39 Ga0114129_10547917 3300009147 Bacteria 1505
40 Ga0114129_10706782 3300009147 Unclassified 1295
41 Ga0105249_10568161 3300009553 Bacteria 1186
42 Ga0105249_11100864 3300009553 Unclassified 864
43 Ga0105239_10625182 3300010375 Bacteria 1229
44 Ga0105239_11869050 3300010375 Unclassified 696
45 Ga0105239_12548236 3300010375 Unclassified 596
46 Ga0105246_10033710 3300011119 Archaea 3406
47 Ga0157374_10817779 3300013296 Unclassified 948
48 Ga0163162_10191580 3300013306 Unclassified 2172
49 Ga0157372_10444904 3300013307 Unclassified 1510
50 Ga0207695_10937980 3300025913 Unclassified 745
51 Ga0207671_11231053 3300025914 Unclassified 585
52 Ga0207663_10209158 3300025916 Unclassified 1413
53 Ga0207662_10064518 3300025918 Bacteria 2203
54 Ga0207667_10086877 3300025949 Bacteria 3235
55 Ga0207667_11180302 3300025949 Bacteria 746
56 Ga0207708_11833038 3300026075 Bacteria 532
57 Ga0207702_10988164 3300026078 Unclassified 835
58 Ga0207698_10014663 3300026142 Bacteria 5219
59 Ga0209995_1003141 3300027471 Unclassified 2624
60 Ga0207428_10323337 3300027907 Unclassified 1139
61 Ga0265323_10129233 3300028653 Bacteria 819
62 Ga0307511_10011331 3300030521 Bacteria 8787
63 Ga0265330_10092230 3300031235 Bacteria 1300
64 Ga0265330_10463168 3300031235 Bacteria 538
65 Ga0265320_10086137 3300031240 Bacteria 1461
66 Ga0265329_10075462 3300031242 Bacteria 1067
67 Ga0265316_10003806 3300031344 Bacteria 15150
68 Ga0265316_10022607 3300031344 Bacteria 5296
69 Ga0265316_10054256 3300031344 Bacteria 3138
70 Ga0265316_10119645 3300031344 Bacteria 1990
71 Ga0265316_10731068 3300031344 Bacteria 696
72 Ga0265316_10793964 3300031344 Bacteria 664
73 Ga0307408_102167278 3300031548 Unclassified 537
74 Ga0316575_10014944 3300031665 Bacteria 2922
75 Ga0316579_10000358 3300031691 Bacteria 14383
76 Ga0316579_10040975 3300031691 Plasmid 2149
77 Ga0265342_10030974 3300031712 Bacteria 3311
78 Ga0265342_10270393 3300031712 Bacteria 902
79 Ga0316576_10023456 3300031727 Bacteria 4298
80 Ga0316576_10082403 3300031727 Bacteria 2388
81 Ga0316576_10171685 3300031727 Bacteria 1636
82 Ga0316578_10000464 3300031728 Bacteria 13512
83 Ga0316578_10005116 3300031728 Bacteria 6313
84 Ga0316578_10008066 3300031728 Bacteria 5327
85 Ga0316577_10004457 3300031733 Bacteria 7227
86 Ga0316577_10035352 3300031733 Plasmid 2792
87 Ga0316577_10085855 3300031733 Plasmid 1761
88 Ga0316577_10090039 3300031733 Bacteria 1717
89 Ga0316577_10300118 3300031733 Bacteria 910
90 Ga0316577_10594809 3300031733 Bacteria 629
91 Ga0307411_12159607 3300032005 Unclassified 522
92 Ga0316583_10035423 3300032133 Bacteria 1771
93 Ga0316583_10308124 3300032133 Unclassified 548
94 Ga0316585_10000326 3300032137 Bacteria 10739
95 Ga0316585_10002952 3300032137 Unclassified 4644
96 Ga0316585_10045261 3300032137 Unclassified 1407
97 Ga0316585_10148322 3300032137 Unclassified 774
98 Ga0316585_10159894 3300032137 Unclassified 744
99 Ga0316580_10002379 3300032139 Bacteria 5157
100 Ga0316580_10014204 3300032139 Bacteria 2432
101 Ga0316593_10060763 3300032168 Bacteria 1291
102 Ga0316593_10297303 3300032168 Bacteria 611
103 Ga0316592_1020873 3300033524 Unclassified 1392
104 Ga0316588_1008063 3300033528 Bacteria 2157
105 Ga0316596_1010102 3300033541 Unclassified 2278
106 Ga0373959_0001061 3300034820 Bacteria 4504
107 Ga0373929_0000001 3300035085 Bacteria 956023
108 Ga0316574_0012237 3300035398 Bacteria 4904
109 Ga0316574_0012323 3300035398 Bacteria 4889
110 Ga0316574_0428269 3300035398 Bacteria 831
111 Ga0316582_0000266 3300036647 Bacteria 17726
112 Ga0316582_0002479 3300036647 Bacteria 8687
113 Ga0316582_0016409 3300036647 Bacteria 4257
114 Ga0316582_0017276 3300036647 Bacteria 4170
115 Ga0316582_0028785 3300036647 Bacteria 3369
116 Ga0316582_0156408 3300036647 Unclassified 1543
117 Ga0316582_0708964 3300036647 Unclassified 691
118 Ga0316582_0748720 3300036647 Unclassified 670
119 Ga0316582_0850666 3300036647 Unclassified 625
120 Ga0316584_0009243 3300036712 Bacteria 6830
121 Ga0316584_0018680 3300036712 Bacteria 5003
122 Ga0316584_0028462 3300036712 Bacteria 4121
123 Ga0316584_0092058 3300036712 Bacteria 2270
124 Ga0316584_0292541 3300036712 Bacteria 1181
125 Ga0316584_0323058 3300036712 Bacteria 1113
126 Ga0316584_0787391 3300036712 Bacteria 647
127 Ga0395899_0147424 3300037312 Bacteria 1670
128 Ga0316581_0095801 3300037588 Unclassified 914
129 Ga0316581_0128744 3300037588 Unclassified 780
130 Ga0436364_1039672 3300037853 Bacteria 3796
131 Ga0395901_1231700 3300038443 Bacteria 713
132 Ga0439460_0244416 3300042461 Bacteria 619
133 Ga0453684_1343371 3300044712 Bacteria 744
134 Ga0451576_0378965 3300045051 Bacteria 1483
135 Ga0495580_0308716 3300046472 Unclassified 1076
136 Ga0495669_0035181 3300046684 Bacteria 2211
137 Ga0495602_0743935 3300048088 Unclassified 662
138 Ga0496102_0807258 3300048905 Bacteria 860
139 Ga0496108_0000023 3300048911 Bacteria 186204
140 Ga0496110_0078909 3300048913 Bacteria 2931
141 Ga0496110_0090105 3300048913 Bacteria 2742
142 Ga0496110_0522548 3300048913 Bacteria 1080
143 Ga0501290_077661 3300049513 Unclassified 561
144 Ga0501040_0407436 3300049576 Bacteria 977
145 Ga0501041_0650473 3300049577 Unclassified 674
146 Ga0501074_0713212 3300049590 Unclassified 708
147 Ga0501076_0079626 3300049592 Bacteria 2629
148 Ga0501080_0069103 3300049742 Bacteria 3285
149 Ga0501080_0435030 3300049742 Bacteria 1177
150 Ga0501081_0367626 3300049743 Bacteria 1062
151 Ga0501083_1126849 3300049744 Unclassified 511
152 Ga0501045_0818167 3300049824 Unclassified 686
153 nmdc:mga0k408_572491_c1 3300050493 Bacteria 667
154 nmdc:mga05p37_390967_c1 3300050507 Unclassified 1626
155 nmdc:mga05p37_417976_c1 3300050507 Unclassified 1561
156 nmdc:mga05p37_95588_c1 3300050507 Bacteria 3661
157 nmdc:mga09592_36066_c1 3300050508 Bacteria 4142
158 nmdc:mga09592_944444_c1 3300050508 Unclassified 723
159 nmdc:mga0qj67_329448_c1 3300050509 Unclassified 1236
160 nmdc:mga0qj67_392996_c1 3300050509 Unclassified 1119
161 nmdc:mga06r32_1004679_c1 3300050510 Unclassified 787
162 nmdc:mga08y16_109202_c1 3300050511 Bacteria 2880
163 nmdc:mga0n895_420965_c1 3300050512 Bacteria 1350
164 nmdc:mga0a205_3070_c1 3300050515 Bacteria 3496
165 Ga0501082_0425863 3300060353 Bacteria 1159
166 Ga0501082_1091362 3300060353 Bacteria 698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006847 Ga0075431_100046711 Ga0075431_1000467115 102
2 3300006852 Ga0075433_10568941 Ga0075433_105689411 102
3 3300006871 Ga0075434_100313633 Ga0075434_1003136333 102
4 3300009147 Ga0114129_10706782 Ga0114129_107067822 102
5 3300005563 Ga0068855_100418885 Ga0068855_1004188852 106
6 3300025949 Ga0207667_11180302 Ga0207667_111803022 106
7 3300027471 Ga0209995_1003141 Ga0209995_10031414 106
8 3300031665 Ga0316575_10014944 Ga0316575_100149443 106
9 3300031691 Ga0316579_10000358 Ga0316579_1000035810 106
10 3300031727 Ga0316576_10171685 Ga0316576_101716853 106
11 3300031728 Ga0316578_10000464 Ga0316578_100004648 106
12 3300031733 Ga0316577_10004457 Ga0316577_100044578 106
13 3300031733 Ga0316577_10035352 Ga0316577_100353526 106
14 3300032133 Ga0316583_10308124 Ga0316583_103081241 106
15 3300032137 Ga0316585_10000326 Ga0316585_100003265 106
16 3300032139 Ga0316580_10002379 Ga0316580_100023794 106
17 3300032168 Ga0316593_10060763 Ga0316593_100607632 106
18 3300033524 Ga0316592_1020873 Ga0316592_10208731 106
19 3300033528 Ga0316588_1008063 Ga0316588_10080634 106
20 3300033541 Ga0316596_1010102 Ga0316596_10101024 106
21 3300035398 Ga0316574_0012323 Ga0316574_0012323_3080_3400 106
22 3300036647 Ga0316582_0000266 Ga0316582_0000266_10742_11062 106
23 3300036647 Ga0316582_0017276 Ga0316582_0017276_2710_3030 106
24 3300036647 Ga0316582_0156408 Ga0316582_0156408_36_356 106
25 3300036647 Ga0316582_0748720 Ga0316582_0748720_169_489 106
26 3300036712 Ga0316584_0028462 Ga0316584_0028462_3159_3479 106
27 3300036712 Ga0316584_0787391 Ga0316584_0787391_21_341 106
28 3300037588 Ga0316581_0095801 Ga0316581_0095801_536_856 106
29 3300037853 Ga0436364_1039672 Ga0436364_1039672_2626_2946 106
30 3300005344 Ga0070661_100373109 Ga0070661_1003731092 107
31 3300005444 Ga0070694_100488268 Ga0070694_1004882683 107
32 3300005467 Ga0070706_100133629 Ga0070706_1001336295 107
33 3300005563 Ga0068855_100014837 Ga0068855_1000148374 107
34 3300005578 Ga0068854_100089735 Ga0068854_1000897351 107
35 3300005614 Ga0068856_101029893 Ga0068856_1010298932 107
36 3300005616 Ga0068852_100026538 Ga0068852_1000265384 107
37 3300009093 Ga0105240_10662124 Ga0105240_106621242 107
38 3300013307 Ga0157372_10444904 Ga0157372_104449043 107
39 3300025913 Ga0207695_10937980 Ga0207695_109379802 107
40 3300025949 Ga0207667_10086877 Ga0207667_100868772 107
41 3300026078 Ga0207702_10988164 Ga0207702_109881642 107
42 3300026142 Ga0207698_10014663 Ga0207698_100146634 107
43 3300028653 Ga0265323_10129233 Ga0265323_101292332 107
44 3300030521 Ga0307511_10011331 Ga0307511_100113313 107
45 3300031235 Ga0265330_10092230 Ga0265330_100922302 107
46 3300031344 Ga0265316_10054256 Ga0265316_100542562 107
47 3300031344 Ga0265316_10731068 Ga0265316_107310681 107
48 3300031712 Ga0265342_10270393 Ga0265342_102703932 107
49 3300031727 Ga0316576_10023456 Ga0316576_100234563 107
50 3300031727 Ga0316576_10082403 Ga0316576_100824034 107
51 3300031728 Ga0316578_10005116 Ga0316578_100051164 107
52 3300031728 Ga0316578_10008066 Ga0316578_100080664 107
53 3300031733 Ga0316577_10090039 Ga0316577_100900394 107
54 3300031733 Ga0316577_10300118 Ga0316577_103001181 107
55 3300032133 Ga0316583_10035423 Ga0316583_100354233 107
56 3300032137 Ga0316585_10002952 Ga0316585_100029522 107
57 3300032137 Ga0316585_10148322 Ga0316585_101483221 107
58 3300032137 Ga0316585_10159894 Ga0316585_101598942 107
59 3300032139 Ga0316580_10014204 Ga0316580_100142042 107
60 3300032168 Ga0316593_10297303 Ga0316593_102973031 107
61 3300035085 Ga0373929_0000001 Ga0373929_0000001_880476_880799 107
62 3300035398 Ga0316574_0428269 Ga0316574_0428269_451_774 107
63 3300036647 Ga0316582_0002479 Ga0316582_0002479_6660_6983 107
64 3300036647 Ga0316582_0016409 Ga0316582_0016409_2642_2965 107
65 3300036712 Ga0316584_0009243 Ga0316584_0009243_2765_3088 107
66 3300036712 Ga0316584_0018680 Ga0316584_0018680_4171_4494 107
67 3300036712 Ga0316584_0292541 Ga0316584_0292541_52_375 107
68 3300037588 Ga0316581_0128744 Ga0316581_0128744_385_708 107
69 3300038443 Ga0395901_1231700 Ga0395901_1231700_281_604 107
70 3300044712 Ga0453684_1343371 Ga0453684_1343371_19_342 107
71 3300046472 Ga0495580_0308716 Ga0495580_0308716_37_360 107
72 3300046684 Ga0495669_0035181 Ga0495669_0035181_964_1287 107
73 3300048913 Ga0496110_0090105 Ga0496110_0090105_1527_1850 107
74 3300005340 Ga0070689_101768578 Ga0070689_1017685781 108
75 3300005365 Ga0070688_100907605 Ga0070688_1009076052 108
76 3300005365 Ga0070688_101766094 Ga0070688_1017660941 108
77 3300005441 Ga0070700_101811031 Ga0070700_1018110311 108
78 3300005444 Ga0070694_100837006 Ga0070694_1008370062 108
79 3300005466 Ga0070685_10245711 Ga0070685_102457113 108
80 3300005471 Ga0070698_100687810 Ga0070698_1006878102 108
81 3300005544 Ga0070686_100445496 Ga0070686_1004454962 108
82 3300005719 Ga0068861_100981814 Ga0068861_1009818141 108
83 3300006844 Ga0075428_100745788 Ga0075428_1007457882 108
84 3300006852 Ga0075433_10054266 Ga0075433_100542665 108
85 3300009147 Ga0114129_10307160 Ga0114129_103071601 108
86 3300009553 Ga0105249_10568161 Ga0105249_105681612 108
87 3300009553 Ga0105249_11100864 Ga0105249_111008642 108
88 3300010375 Ga0105239_10625182 Ga0105239_106251822 108
89 3300010375 Ga0105239_11869050 Ga0105239_118690501 108
90 3300013296 Ga0157374_10817779 Ga0157374_108177792 108
91 3300025914 Ga0207671_11231053 Ga0207671_112310531 108
92 3300026075 Ga0207708_11833038 Ga0207708_118330382 108
93 3300031344 Ga0265316_10119645 Ga0265316_101196454 108
94 3300031548 Ga0307408_102167278 Ga0307408_1021672782 108
95 3300032005 Ga0307411_12159607 Ga0307411_121596072 108
96 3300034820 Ga0373959_0001061 Ga0373959_0001061_204_530 108
97 3300037312 Ga0395899_0147424 Ga0395899_0147424_108_434 108
98 3300048905 Ga0496102_0807258 Ga0496102_0807258_132_458 108
99 3300048911 Ga0496108_0000023 Ga0496108_0000023_150335_150661 108
100 3300048913 Ga0496110_0078909 Ga0496110_0078909_855_1181 108
101 3300048913 Ga0496110_0522548 Ga0496110_0522548_10_336 108
102 3300049513 Ga0501290_077661 Ga0501290_077661_180_506 108
103 3300050512 nmdc:mga0n895_420965_c1 nmdc:mga0n895_420965_c1_261_587 108
104 3300050515 nmdc:mga0a205_3070_c1 nmdc:mga0a205_3070_c1_2743_3069 108
105 3300006844 Ga0075428_100506252 Ga0075428_1005062522 109
106 3300031235 Ga0265330_10463168 Ga0265330_104631681 109
107 3300031242 Ga0265329_10075462 Ga0265329_100754621 109
108 3300031344 Ga0265316_10003806 Ga0265316_100038063 109
109 3300031344 Ga0265316_10022607 Ga0265316_100226076 109
110 3300031344 Ga0265316_10793964 Ga0265316_107939642 109
111 3300031712 Ga0265342_10030974 Ga0265342_100309744 109
112 3300048088 Ga0495602_0743935 Ga0495602_0743935_53_382 109
113 3300005439 Ga0070711_100246129 Ga0070711_1002461292 110
114 3300025916 Ga0207663_10209158 Ga0207663_102091583 110
115 3300035398 Ga0316574_0012237 Ga0316574_0012237_402_734 110
116 3300036647 Ga0316582_0028785 Ga0316582_0028785_2550_2882 110
117 3300036647 Ga0316582_0708964 Ga0316582_0708964_53_385 110
118 3300036712 Ga0316584_0092058 Ga0316584_0092058_616_948 110
119 3300036712 Ga0316584_0323058 Ga0316584_0323058_153_485 110
120 3300045051 Ga0451576_0378965 Ga0451576_0378965_1071_1403 110
121 3300010375 Ga0105239_12548236 Ga0105239_125482362 111
122 3300011119 Ga0105246_10033710 Ga0105246_100337103 111
123 3300031733 Ga0316577_10594809 Ga0316577_105948091 111
124 3300036647 Ga0316582_0850666 Ga0316582_0850666_220_555 111
125 3300050493 nmdc:mga0k408_572491_c1 nmdc:mga0k408_572491_c1_152_487 111
126 3300050507 nmdc:mga05p37_390967_c1 nmdc:mga05p37_390967_c1_45_380 111
127 3300031240 Ga0265320_10086137 Ga0265320_100861373 112
128 3300031691 Ga0316579_10040975 Ga0316579_100409752 112
129 3300031733 Ga0316577_10085855 Ga0316577_100858552 112
130 3300032137 Ga0316585_10045261 Ga0316585_100452612 112
131 3300005981 Ga0081538_10074840 Ga0081538_100748402 113
132 3300006846 Ga0075430_100477698 Ga0075430_1004776982 115
133 3300006880 Ga0075429_100179871 Ga0075429_1001798712 115
134 3300006880 Ga0075429_101260825 Ga0075429_1012608252 115
135 3300009094 Ga0111539_10080026 Ga0111539_100800264 115
136 3300009147 Ga0114129_10547917 Ga0114129_105479172 115
137 3300013306 Ga0163162_10191580 Ga0163162_101915801 115
138 3300049576 Ga0501040_0407436 Ga0501040_0407436_187_534 115
139 3300049577 Ga0501041_0650473 Ga0501041_0650473_287_634 115
140 3300049590 Ga0501074_0713212 Ga0501074_0713212_144_500 115
141 3300049592 Ga0501076_0079626 Ga0501076_0079626_917_1264 115
142 3300049742 Ga0501080_0069103 Ga0501080_0069103_2695_3042 115
143 3300049742 Ga0501080_0435030 Ga0501080_0435030_127_483 115
144 3300049743 Ga0501081_0367626 Ga0501081_0367626_173_529 115
145 3300049744 Ga0501083_1126849 Ga0501083_1126849_147_494 115
146 3300049824 Ga0501045_0818167 Ga0501045_0818167_35_382 115
147 3300050507 nmdc:mga05p37_417976_c1 nmdc:mga05p37_417976_c1_615_962 115
148 3300050507 nmdc:mga05p37_95588_c1 nmdc:mga05p37_95588_c1_2528_2875 115
149 3300050508 nmdc:mga09592_36066_c1 nmdc:mga09592_36066_c1_1283_1630 115
150 3300050508 nmdc:mga09592_944444_c1 nmdc:mga09592_944444_c1_22_369 115
151 3300050509 nmdc:mga0qj67_329448_c1 nmdc:mga0qj67_329448_c1_564_911 115
152 3300050509 nmdc:mga0qj67_392996_c1 nmdc:mga0qj67_392996_c1_270_617 115
153 3300050510 nmdc:mga06r32_1004679_c1 nmdc:mga06r32_1004679_c1_259_606 115
154 3300050511 nmdc:mga08y16_109202_c1 nmdc:mga08y16_109202_c1_1518_1865 115
155 3300060353 Ga0501082_0425863 Ga0501082_0425863_776_1132 115
156 3300060353 Ga0501082_1091362 Ga0501082_1091362_65_412 115
157 3300005343 Ga0070687_100009489 Ga0070687_1000094894 116
158 3300025918 Ga0207662_10064518 Ga0207662_100645183 116
159 3300005937 Ga0081455_10009197 Ga0081455_1000919711 118
160 3300006194 Ga0075427_10074449 Ga0075427_100744492 118
161 3300006844 Ga0075428_100432248 Ga0075428_1004322482 118
162 3300006844 Ga0075428_102272264 Ga0075428_1022722642 118
163 3300006846 Ga0075430_101083583 Ga0075430_1010835832 118
164 3300027907 Ga0207428_10323337 Ga0207428_103233371 118
165 3300042461 Ga0439460_0244416 Ga0439460_0244416_158_514 118
166 3300003911 JGI25405J52794_10043476 JGI25405J52794_100434762 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02452

PemK_toxin

PemK-like, MazF-like toxin of type II toxin-antitoxin system

14

116

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l29-assembly1.cif.gz_B the structure of the mazf-mt1 mutant 0.9288 13 118
4mdx-assembly1.cif.gz_B crystal structure of bacillus subtilis mazf in complex with rna 0.9091 14 118
1ne8-assembly1.cif.gz_A-2 ydce protein from bacillus subtilis 0.9077 14 118
4hke-assembly1.cif.gz_A crystal structure of moxt of bacillus anthracis 0.9018 12 118
4mzp-assembly3.cif.gz_E mazf from s. aureus crystal form iii, c2221, 2.7 a 0.9014 14 117
ID Description Score Start End Superfamily
af_P71650_1_116_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.9032 13 117 2.30.30.110
4hkeA00 Mainly Beta;Roll;SH3 type barrels.; 0.9018 12 118 2.30.30.110
af_P9WII5_1_103_2.30.30.110 Mainly Beta;Roll;SH3 type barrels.; 0.8887 10 117 2.30.30.110
5cqyB00 Mainly Beta;Roll;SH3 type barrels.; 0.8779 12 119 2.30.30.110
5ccaB00 Mainly Beta;Roll;SH3 type barrels.; 0.876 35 115 2.30.30.110
ID Description Score Start End GO Terms
AF-A0A524H8Q9-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9938 41 117 GO:0003677
AF-A0A5C8BLT1-F1-model_v4 Type II toxin-antitoxin system PemK/MazF family toxin 0.9837 51 117 GO:0003677
AF-A0A1F7F701-F1-model_v4 Growth inhibitor PemK 0.9834 53 117 GO:0003677
AF-A0A2G9XHG9-F1-model_v4 Growth inhibitor PemK 0.9828 31 117 GO:0003677
GO:0004521
GO:0006402
GO:0016075
AF-A0A1J5CKI5-F1-model_v4 Growth inhibitor PemK 0.9703 49 117 GO:0003677

Feature Viewer

pLDDT pTM Quality
84.13 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map