F247224

General Info

Members Datasets Scaffolds Average Seq Length
165 150 122 232

Family's Representative Sequence

Representative Sequence 3300053104|Ga0500556_0000130|Ga0500556_0000130_2494_3240
Length 248
Sequence MIVAVIPARGGSKRIPRKNIRLFAGRPIIAYSIEAALASELFDRVIVSTDDAEIAEVARAWGAETPFVRAPELSDDYAGTGEVTADAVRRLAELGMAATYVCCIYATAPFVTPASLKQGYELVTRPDASFALTVTTFGFPIQRAIELLPGIGVAPMYPEHTDARSQDLAPAYHDAGQFYWGRADAWTAGEPAYGPHTYPLLLPRHLVQDIDTLEDWQRAEWMYRSLVAAGELSAPRHASRQIADASCR

Samples

Sample ID Description Type Environment
1 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
6 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
7 2643221684 Massilia sp. Root133 Isolate Unclassified
8 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
9 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
10 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
11 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
12 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
13 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
14 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
15 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
16 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
17 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
18 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
19 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
20 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
21 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
22 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
23 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
24 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
25 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
26 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
27 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
28 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
29 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
30 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
31 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
32 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
33 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
34 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
35 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
36 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
37 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
38 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
39 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
40 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
41 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
46 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
77 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
89 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
90 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
95 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
96 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
97 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
104 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
116 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
119 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
120 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
121 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
122 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
132 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
133 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
137 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
138 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
148 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
149 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
150 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.73
Metatranscriptomes 0.61
Isolates 26.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.61
Bulb 0
Endosphere 8.48
Nodule 14.55
Rhizoplane 0.61
Rhizosphere 63.03
Stem 0
Stem Tuber 0
Unclassified 12.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000993 3300002987 Bacteria 12266
2 JGI25406J46586_10088507 3300003203 Bacteria 938
3 rootH1_10079890 3300003316 Bacteria 1591
4 rootH1_10079890 3300003323 Bacteria 7857
5 rootH2_10042799 3300003320 Bacteria 7571
6 rootL2_10002437 3300003322 Bacteria 11057
7 JGI25160J50197_1001369 3300003354 Bacteria 12280
8 JGI25161J50226_1004720 3300003374 Bacteria 2797
9 Ga0055524_1000124 3300003775 Bacteria 90282
10 Ga0055543_1001059 3300004625 Bacteria 12197
11 Ga0065165_1002161 3300005262 Bacteria 17783
12 Ga0065165_1003111 3300005262 Bacteria 12318
13 Ga0070658_10004315 3300005327 Bacteria 11615
14 Ga0070694_100125988 3300005444 Bacteria 1844
15 Ga0070698_100004100 3300005471 Bacteria 16007
16 Ga0070699_100000941 3300005518 Bacteria 27189
17 Ga0070697_100157416 3300005536 Bacteria 1918
18 Ga0070696_100001706 3300005546 Bacteria 14403
19 Ga0068855_100006464 3300005563 Bacteria 14265
20 Ga0081539_10002713 3300005985 Bacteria 24006
21 Ga0079104_1001471 3300006946 Bacteria 15705
22 Ga0105240_10146759 3300009093 Bacteria 2814
23 Ga0157371_10001872 3300013102 Bacteria 21059
24 Ga0157371_10075711 3300013102 Bacteria 2383
25 Ga0157370_10002449 3300013104 Bacteria 22394
26 Ga0157369_10001512 3300013105 Bacteria 28538
27 Ga0163161_10655695 3300017792 Bacteria 870
28 Ga0213872_10000377 3300021361 Bacteria 37517
29 Ga0209436_100846 3300025208 Bacteria 12330
30 Ga0209565_1004046 3300025263 Bacteria 4570
31 Ga0209130_1001822 3300025284 Bacteria 12332
32 Ga0209256_1000268 3300025299 Bacteria 91897
33 Ga0207426_1002282 3300025302 Bacteria 12648
34 Ga0207713_1029880 3300025735 Bacteria 2433
35 Ga0207705_10003362 3300025909 Bacteria 12158
36 Ga0207695_10618626 3300025913 Bacteria 964
37 Ga0207667_10007651 3300025949 Bacteria 12941
38 Ga0209281_1001103 3300027111 Bacteria 19691
39 Ga0265763_1000946 3300030763 Bacteria 1947
40 Ga0265332_10000004 3300031238 Bacteria 426592
41 Ga0265316_10066516 3300031344 Bacteria 2789
42 Ga0316576_10253951 3300031727 Unclassified 1320
43 Ga0316576_10468487 3300031727 Bacteria 929
44 Ga0307516_10003546 3300031730 Bacteria 19953
45 Ga0316583_10045277 3300032133 Unclassified 1554
46 Ga0395899_0000042 3300037312 Bacteria 249820
47 Ga0395900_0000023 3300037418 Bacteria 336048
48 Ga0395900_0000037 3300037418 Bacteria 249211
49 Ga0395898_0000038 3300037466 Bacteria 329063
50 Ga0395898_0000089 3300037466 Bacteria 238002
51 Ga0395905_0000021 3300037471 Bacteria 329054
52 Ga0395901_0000018 3300038443 Bacteria 336048
53 Ga0395901_0000023 3300038443 Bacteria 283968
54 Ga0395901_0019095 3300038443 Bacteria 7010
55 Ga0400484_39896 3300038725 Bacteria 8799
56 Ga0400490_31751 3300038726 Bacteria 15309
57 Ga0400487_55401 3300039110 Bacteria 7560
58 Ga0436361_0328269 3300039447 Bacteria 34583
59 Ga0439447_000161 3300041407 Bacteria 22856
60 Ga0439466_0000202 3300041411 Bacteria 23507
61 Ga0439466_0044224 3300041411 Bacteria 1476
62 Ga0450911_000003 3300042115 Bacteria 237055
63 Ga0450910_008141 3300042147 Bacteria 1471
64 Ga0439446_0008605 3300042156 Bacteria 2716
65 Ga0450901_012335 3300042533 Bacteria 891
66 Ga0451577_0069580 3300042876 Bacteria 3138
67 Ga0466969_0012327 3300044656 Bacteria 4510
68 Ga0466969_0112586 3300044656 Bacteria 1272
69 Ga0453683_0003268 3300044673 Bacteria 12048
70 Ga0466966_0000025 3300044684 Bacteria 107839
71 Ga0466966_0001488 3300044684 Bacteria 15034
72 Ga0466961_0000467 3300044693 Bacteria 25598
73 Ga0466963_0024114 3300044694 Bacteria 3871
74 Ga0466964_0000077 3300044706 Bacteria 22114
75 Ga0453684_0404356 3300044712 Bacteria 1528
76 Ga0466971_0085005 3300044719 Bacteria 1445
77 Ga0451576_0065120 3300045051 Bacteria 3795
78 Ga0466958_0025915 3300045836 Bacteria 3461
79 Ga0495627_025443 3300046453 Bacteria 1919
80 Ga0495591_003843 3300046458 Bacteria 7589
81 Ga0495591_020698 3300046458 Bacteria 2166
82 Ga0495591_022429 3300046458 Bacteria 2040
83 Ga0495591_024349 3300046458 Bacteria 1920
84 Ga0495638_0014332 3300046460 Bacteria 5364
85 Ga0495650_0015520 3300046471 Bacteria 3903
86 Ga0495605_0000032 3300046474 Bacteria 210550
87 Ga0495585_0022773 3300046492 Bacteria 3596
88 Ga0495594_0001838 3300046499 Bacteria 11038
89 Ga0495583_0000052 3300046506 Bacteria 211902
90 Ga0495610_0046737 3300046512 Bacteria 2133
91 Ga0495616_0092639 3300046513 Bacteria 1428
92 Ga0495620_0000019 3300046515 Bacteria 150014
93 Ga0495631_0002043 3300046518 Bacteria 11752
94 Ga0495637_0017908 3300046520 Bacteria 3292
95 Ga0495637_0105037 3300046520 Bacteria 1100
96 Ga0495643_0000373 3300046522 Bacteria 60201
97 Ga0495648_0002902 3300046524 Bacteria 15418
98 Ga0495654_0005769 3300046530 Bacteria 7135
99 Ga0495609_0000032 3300046538 Bacteria 211021
100 Ga0495597_0000852 3300046542 Bacteria 23978
101 Ga0495633_0000040 3300046558 Bacteria 177876
102 Ga0495611_0017813 3300046648 Bacteria 3042
103 Ga0495661_0000037 3300046665 Bacteria 164234
104 Ga0495588_0066910 3300046674 Bacteria 1865
105 Ga0495671_0001628 3300046692 Bacteria 14744
106 Ga0495649_0008608 3300046694 Bacteria 6127
107 Ga0495589_0011231 3300046794 Bacteria 4649
108 Ga0495660_0085608 3300046810 Bacteria 1646
109 Ga0495683_0000011 3300047323 Bacteria 212053
110 Ga0495679_000176 3300047446 Bacteria 57881
111 Ga0495673_0017721 3300047469 Bacteria 3606
112 Ga0495681_0012576 3300047470 Bacteria 4965
113 Ga0496123_0059803 3300048926 Bacteria 2460
114 Ga0495678_000033 3300049459 Bacteria 211804
115 Ga0495678_008076 3300049459 Bacteria 5363
116 Ga0501047_0190906 3300049581 Bacteria 1912
117 Ga0501070_0166710 3300049586 Bacteria 1815
118 Ga0501035_0046504 3300049822 Bacteria 3904
119 Ga0501044_0000447 3300049823 Bacteria 50424
120 Ga0500644_0024977 3300053088 Bacteria 1833
121 Ga0500556_0000130 3300053104 Bacteria 63676
122 Ga0466962_0024756 3300061719 Bacteria 2882

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2806310737 2807407223 199
2 iso_pu_bacteria 2806310745 2807455552 199
3 3300049581 Ga0501047_0190906 Ga0501047_0190906_24_626 200
4 3300006946 Ga0079104_1001471 Ga0079104_10014718 207
5 3300027111 Ga0209281_1001103 Ga0209281_10011038 207
6 3300046692 Ga0495671_0001628 Ga0495671_0001628_6110_6814 212
7 3300046694 Ga0495649_0008608 Ga0495649_0008608_5122_5826 212
8 3300031727 Ga0316576_10468487 Ga0316576_104684872 221
9 3300049586 Ga0501070_0166710 Ga0501070_0166710_103_810 224
10 iso_pu_bacteria 2939651529 2939653154 224
11 3300045051 Ga0451576_0065120 Ga0451576_0065120_2534_3211 225
12 iso_pu_bacteria 2513237351 2514591084 225
13 iso_pu_bacteria 2765235838 2765567656 226
14 3300005327 Ga0070658_10004315 Ga0070658_100043157 227
15 3300009093 Ga0105240_10146759 Ga0105240_101467593 227
16 3300013104 Ga0157370_10002449 Ga0157370_100024495 227
17 3300025909 Ga0207705_10003362 Ga0207705_100033626 227
18 3300025913 Ga0207695_10618626 Ga0207695_106186261 227
19 3300038726 Ga0400490_31751 Ga0400490_31751_11240_11944 228
20 3300039110 Ga0400487_55401 Ga0400487_55401_5917_6621 228
21 iso_pu_bacteria 2510065055 2510294485 228
22 iso_pu_bacteria 2547132512 2548848299 228
23 iso_pu_bacteria 2643221684 2644475209 228
24 iso_pu_bacteria 2773857672 2774131743 228
25 iso_pu_bacteria 2808606415 2809130422 228
26 iso_pu_bacteria 2808606419 2809150101 228
27 iso_pu_bacteria 2839094727 2839099608 228
28 iso_pu_bacteria 2852618963 2852621679 228
29 iso_pu_bacteria 2919497567 2919498457 228
30 iso_pu_bacteria 2984504281 2984508192 228
31 3300046458 Ga0495591_020698 Ga0495591_020698_213_908 229
32 3300046458 Ga0495591_022429 Ga0495591_022429_587_1282 229
33 3300046492 Ga0495585_0022773 Ga0495585_0022773_1984_2679 229
34 3300046520 Ga0495637_0017908 Ga0495637_0017908_1911_2630 229
35 3300049459 Ga0495678_008076 Ga0495678_008076_3398_4093 229
36 3300053088 Ga0500644_0024977 Ga0500644_0024977_796_1485 229
37 iso_pu_bacteria 2600255283 2601625443 229
38 iso_pu_bacteria 2687453392 2688598994 229
39 iso_pu_bacteria 2738543020 2739287882 229
40 iso_pu_bacteria 2738543021 2739293194 229
41 iso_pu_bacteria 2811994881 2812365854 229
42 iso_pu_bacteria 2856364286 2856365987 229
43 iso_pu_bacteria 2869285874 2869287138 229
44 iso_pu_bacteria 2871429161 2871430878 229
45 iso_pu_bacteria 2878745973 2878747510 229
46 iso_pu_bacteria 2903492973 2903503515 229
47 iso_pu_bacteria 2906308376 2906309687 229
48 iso_pu_bacteria 2906321335 2906322762 229
49 iso_pu_bacteria 2923519811 2923519875 229
50 iso_pu_bacteria 2958041894 2958054855 229
51 iso_pu_bacteria 2958130278 2958131537 229
52 iso_pu_bacteria 2958179912 2958181558 229
53 iso_pu_bacteria 2961077736 2961079397 229
54 iso_pu_bacteria 8004387939 8004388854 229
55 iso_pu_bacteria 8004714634 8004715942 229
56 3300003203 JGI25406J46586_10088507 JGI25406J46586_100885072 230
57 3300005985 Ga0081539_10002713 Ga0081539_1000271314 230
58 3300031727 Ga0316576_10253951 Ga0316576_102539511 230
59 iso_pu_bacteria 2791355094 2792641688 230
60 iso_pu_bacteria 2964649959 2964654308 230
61 iso_pu_bacteria 2964663802 2964664207 230
62 iso_pu_bacteria 2977572785 2977576444 230
63 iso_pu_bacteria 643692032 643822808 230
64 3300013102 Ga0157371_10001872 Ga0157371_1000187210 231
65 3300013105 Ga0157369_10001512 Ga0157369_1000151217 231
66 3300038443 Ga0395901_0019095 Ga0395901_0019095_5922_6617 231
67 3300041411 Ga0439466_0044224 Ga0439466_0044224_144_839 231
68 3300042115 Ga0450911_000003 Ga0450911_000003_77700_78395 231
69 3300042156 Ga0439446_0008605 Ga0439446_0008605_1129_1824 231
70 3300042876 Ga0451577_0069580 Ga0451577_0069580_1232_1927 231
71 3300044673 Ga0453683_0003268 Ga0453683_0003268_2247_2942 231
72 3300046674 Ga0495588_0066910 Ga0495588_0066910_992_1687 231
73 iso_pu_bacteria 2510065045 2510252767 231
74 iso_pu_bacteria 2582581283 2585169263 231
75 iso_pu_bacteria 2718217991 2719641870 231
76 iso_pu_bacteria 2842854478 2842854618 231
77 3300003775 Ga0055524_1000124 Ga0055524_100012476 232
78 3300017792 Ga0163161_10655695 Ga0163161_106556952 232
79 3300021361 Ga0213872_10000377 Ga0213872_100003776 232
80 3300025263 Ga0209565_1004046 Ga0209565_10040464 232
81 3300025299 Ga0209256_1000268 Ga0209256_10002687 232
82 3300031238 Ga0265332_10000004 Ga0265332_10000004349 232
83 3300039447 Ga0436361_0328269 Ga0436361_0328269_29590_30288 232
84 3300042533 Ga0450901_012335 Ga0450901_012335_43_741 232
85 3300044656 Ga0466969_0112586 Ga0466969_0112586_462_1160 232
86 3300044684 Ga0466966_0001488 Ga0466966_0001488_6357_7055 232
87 3300046522 Ga0495643_0000373 Ga0495643_0000373_25495_26199 232
88 3300049822 Ga0501035_0046504 Ga0501035_0046504_1912_2610 232
89 3300049823 Ga0501044_0000447 Ga0501044_0000447_12110_12808 232
90 3300003316 rootH1_10079890 rootH1_100798902 233
91 3300003322 rootL2_10002437 rootL2_100024376 233
92 3300032133 Ga0316583_10045277 Ga0316583_100452773 233
93 3300038725 Ga0400484_39896 Ga0400484_39896_2780_3481 233
94 3300044712 Ga0453684_0404356 Ga0453684_0404356_47_748 233
95 iso_pu_bacteria 2917832318 2917834762 233
96 3300005444 Ga0070694_100125988 Ga0070694_1001259883 234
97 3300005471 Ga0070698_100004100 Ga0070698_1000041009 234
98 3300005518 Ga0070699_100000941 Ga0070699_1000009416 234
99 3300005536 Ga0070697_100157416 Ga0070697_1001574163 234
100 3300005546 Ga0070696_100001706 Ga0070696_1000017069 234
101 3300005563 Ga0068855_100006464 Ga0068855_10000646410 234
102 3300025735 Ga0207713_1029880 Ga0207713_10298802 234
103 3300025949 Ga0207667_10007651 Ga0207667_100076519 234
104 3300031730 Ga0307516_10003546 Ga0307516_100035467 234
105 3300037312 Ga0395899_0000042 Ga0395899_0000042_114771_115481 234
106 3300037418 Ga0395900_0000037 Ga0395900_0000037_133732_134442 234
107 3300037466 Ga0395898_0000089 Ga0395898_0000089_134220_134930 234
108 3300038443 Ga0395901_0000023 Ga0395901_0000023_154864_155574 234
109 3300044656 Ga0466969_0012327 Ga0466969_0012327_3018_3728 234
110 3300044684 Ga0466966_0000025 Ga0466966_0000025_56235_56945 234
111 3300044693 Ga0466961_0000467 Ga0466961_0000467_6317_7027 234
112 3300044694 Ga0466963_0024114 Ga0466963_0024114_2366_3076 234
113 3300044719 Ga0466971_0085005 Ga0466971_0085005_230_940 234
114 3300045836 Ga0466958_0025915 Ga0466958_0025915_1294_2004 234
115 3300046453 Ga0495627_025443 Ga0495627_025443_775_1485 234
116 3300046458 Ga0495591_003843 Ga0495591_003843_1492_2202 234
117 3300046458 Ga0495591_024349 Ga0495591_024349_100_810 234
118 3300046460 Ga0495638_0014332 Ga0495638_0014332_1848_2552 234
119 3300046471 Ga0495650_0015520 Ga0495650_0015520_1583_2293 234
120 3300046474 Ga0495605_0000032 Ga0495605_0000032_93702_94412 234
121 3300046499 Ga0495594_0001838 Ga0495594_0001838_6111_6821 234
122 3300046506 Ga0495583_0000052 Ga0495583_0000052_94430_95140 234
123 3300046512 Ga0495610_0046737 Ga0495610_0046737_402_1112 234
124 3300046513 Ga0495616_0092639 Ga0495616_0092639_453_1163 234
125 3300046515 Ga0495620_0000019 Ga0495620_0000019_93745_94455 234
126 3300046518 Ga0495631_0002043 Ga0495631_0002043_8870_9580 234
127 3300046520 Ga0495637_0105037 Ga0495637_0105037_209_919 234
128 3300046524 Ga0495648_0002902 Ga0495648_0002902_14672_15382 234
129 3300046530 Ga0495654_0005769 Ga0495654_0005769_831_1541 234
130 3300046538 Ga0495609_0000032 Ga0495609_0000032_116755_117465 234
131 3300046542 Ga0495597_0000852 Ga0495597_0000852_22132_22842 234
132 3300046558 Ga0495633_0000040 Ga0495633_0000040_83080_83790 234
133 3300046648 Ga0495611_0017813 Ga0495611_0017813_813_1523 234
134 3300046665 Ga0495661_0000037 Ga0495661_0000037_92483_93193 234
135 3300046794 Ga0495589_0011231 Ga0495589_0011231_1508_2218 234
136 3300046810 Ga0495660_0085608 Ga0495660_0085608_670_1380 234
137 3300047323 Ga0495683_0000011 Ga0495683_0000011_94593_95303 234
138 3300047446 Ga0495679_000176 Ga0495679_000176_35193_35903 234
139 3300047469 Ga0495673_0017721 Ga0495673_0017721_1238_1948 234
140 3300047470 Ga0495681_0012576 Ga0495681_0012576_2988_3698 234
141 3300048926 Ga0496123_0059803 Ga0496123_0059803_1385_2095 234
142 3300049459 Ga0495678_000033 Ga0495678_000033_117341_118051 234
143 3300061719 Ga0466962_0024756 Ga0466962_0024756_2117_2827 234
144 3300003320 rootH2_10042799 rootH2_100427997 235
145 3300005262 Ga0065165_1002161 Ga0065165_100216112 235
146 3300013102 Ga0157371_10075711 Ga0157371_100757112 235
147 3300030763 Ga0265763_1000946 Ga0265763_10009461 235
148 3300041407 Ga0439447_000161 Ga0439447_000161_12248_12955 235
149 3300041411 Ga0439466_0000202 Ga0439466_0000202_13217_13924 235
150 3300042147 Ga0450910_008141 Ga0450910_008141_293_1000 235
151 3300044706 Ga0466964_0000077 Ga0466964_0000077_6939_7658 235
152 3300002987 JGI25159J45721_1000993 JGI25159J45721_10009934 236
153 3300003354 JGI25160J50197_1001369 JGI25160J50197_10013698 236
154 3300003374 JGI25161J50226_1004720 JGI25161J50226_10047202 236
155 3300004625 Ga0055543_1001059 Ga0055543_10010594 236
156 3300005262 Ga0065165_1003111 Ga0065165_10031114 236
157 3300025208 Ga0209436_100846 Ga0209436_1008469 236
158 3300025284 Ga0209130_1001822 Ga0209130_10018224 236
159 3300025302 Ga0207426_1002282 Ga0207426_10022824 236
160 3300031344 Ga0265316_10066516 Ga0265316_100665163 236
161 3300037418 Ga0395900_0000023 Ga0395900_0000023_331780_332499 236
162 3300037466 Ga0395898_0000038 Ga0395898_0000038_325374_326093 236
163 3300037471 Ga0395905_0000021 Ga0395905_0000021_325374_326093 236
164 3300038443 Ga0395901_0000018 Ga0395901_0000018_331780_332499 236
165 3300053104 Ga0500556_0000130 Ga0500556_0000130_2494_3240 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

4

232

0.83

PF02348

CTP_transf_3

Cytidylyltransferase

3

137

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ifd-assembly2.cif.gz_C crystal structure of cmp-n-acetylneuraminate synthetase from vibrio cholerae in complex with cdp and mg2+. 0.8824 2 220
6ifd-assembly1.cif.gz_A crystal structure of cmp-n-acetylneuraminate synthetase from vibrio cholerae in complex with cdp and mg2+. 0.8747 2 223
1eyr-assembly1.cif.gz_B structure of a sialic acid activating synthetase, cmp acylneuraminate synthetase in the presence and absence of cdp 0.872 2 222
6ckj-assembly1.cif.gz_A n. meningitidis cmp-sialic acid synthetase, ligand-free 0.8698 2 224
6ifd-assembly2.cif.gz_D crystal structure of cmp-n-acetylneuraminate synthetase from vibrio cholerae in complex with cdp and mg2+. 0.8662 2 220
ID Description Score Start End Superfamily
6ckkA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.857 2 224 3.90.550.10
af_A0A2R8RQE4_29_167_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8531 1 129 3.90.550.10
af_H9BFW7_23_246_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8506 3 222 3.90.550.10
6ckkA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8356 2 224 3.90.550.10
af_H9BFW7_23_246_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8114 3 222 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4Q6D4E4-F1-model_v4 deleted 0.992 1 116
AF-A0A529I0V0-F1-model_v4 Pseudaminic acid cytidylyltransferase 0.99 1 103 GO:0008781
AF-A0A7C7X5Y8-F1-model_v4 Pseudaminic acid cytidylyltransferase (EC 2.7.7.81) 0.9817 2 225 GO:0008781
AF-A0A1S6TLZ8-F1-model_v4 deleted 0.9813 1 227
AF-A0A800E8N5-F1-model_v4 Pseudaminic acid cytidylyltransferase (EC 2.7.7.81) 0.9777 1 205 GO:0008781

Feature Viewer

pLDDT pTM Quality
93.99 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map