F247085

General Info

Members Datasets Scaffolds Average Seq Length
165 120 161 140

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0007107|Ga0501033_0007107_8142_8621
Length 159
Sequence VRKGGADVGGRCFTFRMDIADPQTVFPKIVATVLDTTDARRLAEFYRELLGYSYFPGDEPPADSGPDDADWLRLREPGGAFRLSFQQVEKLDPPTWPEGPVPQQLHLDFAVGSAAELQRQKARALELGATLLRDRFDDPDEPLFVFADPAGHPFCIFVG

Samples

Sample ID Description Type Environment
1 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
2 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
3 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
73 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
83 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
84 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
85 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
86 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
87 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
88 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
117 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.94
Metatranscriptomes 3.64
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 6.06
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10004220 3300003373 Bacteria 3497
2 JGI25407J50210_10010946 3300003373 Bacteria 2314
3 JGI25407J50210_10066529 3300003373 Bacteria 901
4 Ga0070658_10015386 3300005327 Bacteria 6123
5 Ga0070676_10275266 3300005328 Bacteria 1132
6 Ga0070683_100045344 3300005329 Bacteria 4057
7 Ga0070683_100448892 3300005329 Bacteria 1230
8 Ga0070677_10137436 3300005333 Bacteria 1123
9 Ga0070689_101641793 3300005340 Bacteria 584
10 Ga0070691_10300867 3300005341 Bacteria 876
11 Ga0070668_100093402 3300005347 Bacteria 2374
12 Ga0070668_101577516 3300005347 Bacteria 601
13 Ga0070674_100087341 3300005356 Bacteria 2242
14 Ga0070673_100610084 3300005364 Bacteria 996
15 Ga0070659_101298347 3300005366 Bacteria 645
16 Ga0070667_100048044 3300005367 Bacteria 3592
17 Ga0070714_101103040 3300005435 Bacteria 773
18 Ga0070685_10233328 3300005466 Bacteria 1211
19 Ga0068854_101609310 3300005578 Bacteria 592
20 Ga0068856_100083340 3300005614 Bacteria 3175
21 Ga0068859_100321941 3300005617 Bacteria 1640
22 Ga0068864_100250993 3300005618 Bacteria 1643
23 Ga0068861_100168308 3300005719 Bacteria 1814
24 Ga0068861_101194656 3300005719 Bacteria 735
25 Ga0068863_100105621 3300005841 Bacteria 2679
26 Ga0068862_100038918 3300005844 Bacteria 4037
27 Ga0081455_10002490 3300005937 Bacteria 21865
28 Ga0081538_10001418 3300005981 Bacteria 24637
29 Ga0081538_10003211 3300005981 Bacteria 15539
30 Ga0081538_10005503 3300005981 Bacteria 11376
31 Ga0081538_10024072 3300005981 Bacteria 4350
32 Ga0081538_10043569 3300005981 Bacteria 2815
33 Ga0081538_10056626 3300005981 Bacteria 2294
34 Ga0081538_10095429 3300005981 Bacteria 1519
35 Ga0081538_10113845 3300005981 Bacteria 1320
36 Ga0068871_101088767 3300006358 Bacteria 747
37 Ga0097620_100321934 3300006931 Bacteria 1640
38 Ga0105245_11742714 3300009098 Bacteria 675
39 Ga0114129_11705750 3300009147 Bacteria 768
40 Ga0105243_10762762 3300009148 Bacteria 950
41 Ga0105243_11044121 3300009148 Bacteria 822
42 Ga0105241_11205829 3300009174 Bacteria 717
43 Ga0105248_11419593 3300009177 Bacteria 785
44 Ga0105238_11354684 3300009551 Bacteria 738
45 Ga0157369_10005495 3300013105 Bacteria 14727
46 Ga0157369_10384327 3300013105 Bacteria 1457
47 Ga0163162_12133350 3300013306 Bacteria 643
48 Ga0157372_10203630 3300013307 Bacteria 2293
49 Ga0157375_10043996 3300013308 Bacteria 4334
50 Ga0157375_11373796 3300013308 Bacteria 832
51 Ga0163163_10713307 3300014325 Bacteria 1066
52 Ga0157380_10754769 3300014326 Bacteria 985
53 Ga0157377_10315768 3300014745 Bacteria 1036
54 Ga0157377_10989071 3300014745 Bacteria 636
55 Ga0157376_11402615 3300014969 Bacteria 730
56 Ga0163161_10703186 3300017792 Bacteria 842
57 Ga0206356_11221320 3300020070 Bacteria 922
58 Ga0206350_10548012 3300020080 Bacteria 909
59 Ga0206354_10433955 3300020081 Bacteria 860
60 Ga0206353_10927939 3300020082 Bacteria 789
61 Ga0206353_11285980 3300020082 Bacteria 1185
62 Ga0224712_10136103 3300022467 Bacteria 1077
63 Ga0207705_10023947 3300025909 Bacteria 4357
64 Ga0207646_10673818 3300025922 Bacteria 926
65 Ga0207659_10994284 3300025926 Bacteria 722
66 Ga0207687_11115819 3300025927 Bacteria 677
67 Ga0207664_10708725 3300025929 Bacteria 905
68 Ga0207709_10150475 3300025935 Bacteria 1611
69 Ga0207661_10362237 3300025944 Bacteria 1310
70 Ga0207661_11050829 3300025944 Unclassified 750
71 Ga0207668_10199729 3300025972 Bacteria 1591
72 Ga0207668_11434440 3300025972 Bacteria 623
73 Ga0207658_10029485 3300025986 Bacteria 3876
74 Ga0207658_10042923 3300025986 Bacteria 3284
75 Ga0207678_10160671 3300026067 Bacteria 1919
76 Ga0207678_10384356 3300026067 Bacteria 1214
77 Ga0207702_10967445 3300026078 Bacteria 844
78 Ga0207702_11082292 3300026078 Bacteria 795
79 Ga0207641_10192312 3300026088 Bacteria 1876
80 Ga0207676_10913047 3300026095 Bacteria 862
81 Ga0207675_100057368 3300026118 Bacteria 3633
82 Ga0207683_11225164 3300026121 Bacteria 695
83 Ga0207698_10306031 3300026142 Unclassified 1482
84 Ga0268264_10043615 3300028381 Bacteria 3718
85 Ga0307513_10010973 3300031456 Bacteria 11305
86 Ga0307408_100220680 3300031548 Bacteria 1547
87 Ga0307413_10174074 3300031824 Bacteria 1527
88 Ga0307413_10339805 3300031824 Bacteria 1154
89 Ga0307413_10931480 3300031824 Bacteria 740
90 Ga0307410_10341129 3300031852 Bacteria 1194
91 Ga0326468_10000433 3300031889 Bacteria 4464
92 Ga0307407_10374923 3300031903 Bacteria 1014
93 Ga0307407_10455622 3300031903 Bacteria 929
94 Ga0307412_10837513 3300031911 Bacteria 801
95 Ga0307409_100031408 3300031995 Bacteria 3833
96 Ga0307409_100253143 3300031995 Bacteria 1611
97 Ga0307409_100360937 3300031995 Bacteria 1374
98 Ga0307409_100681569 3300031995 Bacteria 1025
99 Ga0307409_100846003 3300031995 Bacteria 925
100 Ga0307414_11080981 3300032004 Bacteria 740
101 Ga0307411_10312029 3300032005 Bacteria 1266
102 Ga0307411_11289858 3300032005 Bacteria 665
103 Ga0307415_100033281 3300032126 Bacteria 3345
104 Ga0373939_0057455 3300035114 Bacteria 1228
105 Ga0373956_0000824 3300035119 Bacteria 12904
106 Ga0373925_1241844 3300037068 Bacteria 612
107 Ga0436364_0735437 3300037853 Bacteria 695
108 Ga0436362_0476620 3300039453 Bacteria 1499
109 Ga0439465_0018607 3300041413 Bacteria 2171
110 Ga0439431_0209522 3300041997 Bacteria 570
111 Ga0439448_0043171 3300042005 Bacteria 1463
112 Ga0439432_175928 3300042006 Bacteria 624
113 Ga0439455_0110059 3300042012 Bacteria 766
114 Ga0439463_024176 3300042016 Bacteria 1522
115 Ga0450906_053542 3300042145 Bacteria 714
116 Ga0466969_0022266 3300044656 Bacteria 3272
117 Ga0466972_0024669 3300044658 Bacteria 2984
118 Ga0466965_0080099 3300044683 Bacteria 1650
119 Ga0466965_0082981 3300044683 Bacteria 1622
120 Ga0466965_0149131 3300044683 Bacteria 1222
121 Ga0466966_0383212 3300044684 Bacteria 845
122 Ga0466966_0421862 3300044684 Bacteria 802
123 Ga0466961_0039844 3300044693 Bacteria 3011
124 Ga0466963_0091845 3300044694 Bacteria 2068
125 Ga0466964_0265141 3300044706 Bacteria 852
126 Ga0466970_0033502 3300044765 Bacteria 2715
127 Ga0466957_0001565 3300044842 Bacteria 12049
128 Ga0466957_0069835 3300044842 Bacteria 2170
129 Ga0466957_0171421 3300044842 Bacteria 1414
130 Ga0466957_0408953 3300044842 Bacteria 929
131 Ga0466960_0207299 3300044901 Bacteria 1073
132 Ga0466959_0048740 3300045049 Bacteria 3113
133 Ga0466958_0064145 3300045836 Bacteria 2240
134 Ga0466958_0487944 3300045836 Bacteria 799
135 Ga0466958_0666780 3300045836 Bacteria 677
136 Ga0466967_0058691 3300045976 Bacteria 3402
137 Ga0466967_2310363 3300045976 Unclassified 533
138 Ga0496105_0386199 3300048908 Bacteria 1114
139 Ga0496108_0283389 3300048911 Bacteria 1442
140 Ga0496108_0403441 3300048911 Bacteria 1194
141 Ga0496109_0157127 3300048912 Bacteria 2130
142 Ga0496109_0415114 3300048912 Bacteria 1272
143 Ga0496110_0140009 3300048913 Bacteria 2187
144 Ga0496111_0019622 3300048914 Bacteria 4701
145 Ga0496111_0042832 3300048914 Bacteria 3252
146 Ga0496111_0599026 3300048914 Bacteria 807
147 Ga0496114_1004346 3300048917 Bacteria 718
148 Ga0501033_0007107 3300049570 Bacteria 8738
149 Ga0501033_0461269 3300049570 Bacteria 882
150 Ga0501034_0551995 3300049571 Bacteria 1061
151 Ga0501036_1208665 3300049572 Bacteria 616
152 Ga0501039_0439932 3300049575 Bacteria 1024
153 Ga0501042_0000243 3300049578 Bacteria 26410
154 Ga0501047_0021415 3300049581 Bacteria 6206
155 Ga0501083_0000003 3300049744 Bacteria 235949
156 Ga0501044_0074238 3300049823 Bacteria 3456
157 Ga0501044_1357263 3300049823 Bacteria 577
158 Ga0495619_0760329 3300053085 Bacteria 657
159 Ga0500583_0214946 3300053092 Bacteria 954
160 Ga0500559_0020798 3300053136 Bacteria 2777
161 Ga0466962_0012797 3300061719 Bacteria 4036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025926 Ga0207659_10994284 Ga0207659_109942842 116
2 3300005329 Ga0070683_100045344 Ga0070683_1000453444 126
3 3300020070 Ga0206356_11221320 Ga0206356_112213202 126
4 3300025944 Ga0207661_10362237 Ga0207661_103622372 126
5 3300042006 Ga0439432_175928 Ga0439432_175928_98_490 130
6 iso_pu_bacteria 2751185782 2753271249 130
7 3300005356 Ga0070674_100087341 Ga0070674_1000873412 131
8 3300048911 Ga0496108_0403441 Ga0496108_0403441_289_684 131
9 iso_pu_bacteria 2857710386 2857710861 131
10 3300005333 Ga0070677_10137436 Ga0070677_101374362 132
11 3300005340 Ga0070689_101641793 Ga0070689_1016417931 132
12 3300005341 Ga0070691_10300867 Ga0070691_103008671 132
13 3300005347 Ga0070668_101577516 Ga0070668_1015775161 132
14 3300006358 Ga0068871_101088767 Ga0068871_1010887672 132
15 3300009148 Ga0105243_11044121 Ga0105243_110441212 132
16 3300009174 Ga0105241_11205829 Ga0105241_112058291 132
17 3300009551 Ga0105238_11354684 Ga0105238_113546842 132
18 3300013105 Ga0157369_10005495 Ga0157369_100054958 132
19 3300013306 Ga0163162_12133350 Ga0163162_121333501 132
20 3300013307 Ga0157372_10203630 Ga0157372_102036304 132
21 3300013308 Ga0157375_10043996 Ga0157375_100439962 132
22 3300014326 Ga0157380_10754769 Ga0157380_107547691 132
23 3300017792 Ga0163161_10703186 Ga0163161_107031862 132
24 3300025935 Ga0207709_10150475 Ga0207709_101504752 132
25 3300025972 Ga0207668_11434440 Ga0207668_114344401 132
26 3300044842 Ga0466957_0171421 Ga0466957_0171421_247_645 132
27 3300045836 Ga0466958_0064145 Ga0466958_0064145_24_422 132
28 3300048912 Ga0496109_0157127 Ga0496109_0157127_262_660 132
29 3300048914 Ga0496111_0599026 Ga0496111_0599026_113_511 132
30 3300048917 Ga0496114_1004346 Ga0496114_1004346_231_677 132
31 3300009147 Ga0114129_11705750 Ga0114129_117057501 133
32 3300005329 Ga0070683_100448892 Ga0070683_1004488922 134
33 3300005347 Ga0070668_100093402 Ga0070668_1000934022 134
34 3300005364 Ga0070673_100610084 Ga0070673_1006100842 134
35 3300005367 Ga0070667_100048044 Ga0070667_1000480442 134
36 3300005466 Ga0070685_10233328 Ga0070685_102333282 134
37 3300005614 Ga0068856_100083340 Ga0068856_1000833401 134
38 3300005617 Ga0068859_100321941 Ga0068859_1003219412 134
39 3300005719 Ga0068861_101194656 Ga0068861_1011946562 134
40 3300005841 Ga0068863_100105621 Ga0068863_1001056212 134
41 3300005844 Ga0068862_100038918 Ga0068862_1000389184 134
42 3300006931 Ga0097620_100321934 Ga0097620_1003219342 134
43 3300009098 Ga0105245_11742714 Ga0105245_117427142 134
44 3300014325 Ga0163163_10713307 Ga0163163_107133072 134
45 3300020082 Ga0206353_11285980 Ga0206353_112859801 134
46 3300025927 Ga0207687_11115819 Ga0207687_111158192 134
47 3300025929 Ga0207664_10708725 Ga0207664_107087252 134
48 3300025972 Ga0207668_10199729 Ga0207668_101997292 134
49 3300025986 Ga0207658_10029485 Ga0207658_100294852 134
50 3300026078 Ga0207702_10967445 Ga0207702_109674452 134
51 3300026088 Ga0207641_10192312 Ga0207641_101923122 134
52 3300028381 Ga0268264_10043615 Ga0268264_100436152 134
53 3300053092 Ga0500583_0214946 Ga0500583_0214946_484_888 134
54 3300020081 Ga0206354_10433955 Ga0206354_104339552 135
55 3300020082 Ga0206353_10927939 Ga0206353_109279392 135
56 3300049572 Ga0501036_1208665 Ga0501036_1208665_187_594 135
57 iso_pu_bacteria 2795385470 2795780553 135
58 3300049823 Ga0501044_1357263 Ga0501044_1357263_61_471 136
59 3300053136 Ga0500559_0020798 Ga0500559_0020798_1428_1865 136
60 3300031911 Ga0307412_10837513 Ga0307412_108375132 137
61 3300031995 Ga0307409_100253143 Ga0307409_1002531432 137
62 3300037068 Ga0373925_1241844 Ga0373925_1241844_116_529 137
63 3300044683 Ga0466965_0149131 Ga0466965_0149131_344_757 137
64 3300044842 Ga0466957_0069835 Ga0466957_0069835_1742_2155 137
65 3300044842 Ga0466957_0408953 Ga0466957_0408953_20_433 137
66 3300048908 Ga0496105_0386199 Ga0496105_0386199_262_675 137
67 3300048911 Ga0496108_0283389 Ga0496108_0283389_334_747 137
68 3300048912 Ga0496109_0415114 Ga0496109_0415114_378_791 137
69 3300048913 Ga0496110_0140009 Ga0496110_0140009_1209_1622 137
70 3300048914 Ga0496111_0019622 Ga0496111_0019622_3746_4159 137
71 3300053085 Ga0495619_0760329 Ga0495619_0760329_110_523 137
72 3300026067 Ga0207678_10160671 Ga0207678_101606712 138
73 iso_pu_bacteria 8003870546 8003872694 138
74 3300005618 Ga0068864_100250993 Ga0068864_1002509932 139
75 3300009148 Ga0105243_10762762 Ga0105243_107627622 139
76 3300014969 Ga0157376_11402615 Ga0157376_114026152 139
77 3300025986 Ga0207658_10042923 Ga0207658_100429232 139
78 3300026078 Ga0207702_11082292 Ga0207702_110822922 139
79 3300026095 Ga0207676_10913047 Ga0207676_109130472 139
80 3300026142 Ga0207698_10306031 Ga0207698_103060312 139
81 3300031456 Ga0307513_10010973 Ga0307513_100109732 139
82 3300035114 Ga0373939_0057455 Ga0373939_0057455_266_685 139
83 3300042012 Ga0439455_0110059 Ga0439455_0110059_316_747 139
84 3300044683 Ga0466965_0082981 Ga0466965_0082981_291_710 139
85 3300044684 Ga0466966_0421862 Ga0466966_0421862_145_564 139
86 3300045049 Ga0466959_0048740 Ga0466959_0048740_689_1108 139
87 3300045836 Ga0466958_0666780 Ga0466958_0666780_144_563 139
88 3300045976 Ga0466967_2310363 Ga0466967_2310363_41_460 139
89 3300005328 Ga0070676_10275266 Ga0070676_102752662 140
90 3300005937 Ga0081455_10002490 Ga0081455_1000249014 140
91 3300005981 Ga0081538_10003211 Ga0081538_1000321113 140
92 3300025944 Ga0207661_11050829 Ga0207661_110508292 140
93 3300031889 Ga0326468_10000433 Ga0326468_100004335 140
94 3300049570 Ga0501033_0007107 Ga0501033_0007107_8142_8621 140
95 3300049578 Ga0501042_0000243 Ga0501042_0000243_2165_2596 140
96 3300049581 Ga0501047_0021415 Ga0501047_0021415_1028_1507 140
97 3300049744 Ga0501083_0000003 Ga0501083_0000003_219789_220220 140
98 3300049823 Ga0501044_0074238 Ga0501044_0074238_1914_2393 140
99 3300037853 Ga0436364_0735437 Ga0436364_0735437_107_532 141
100 3300044658 Ga0466972_0024669 Ga0466972_0024669_1921_2346 141
101 3300044683 Ga0466965_0080099 Ga0466965_0080099_834_1259 141
102 3300044693 Ga0466961_0039844 Ga0466961_0039844_619_1044 141
103 3300044694 Ga0466963_0091845 Ga0466963_0091845_89_514 141
104 3300044706 Ga0466964_0265141 Ga0466964_0265141_128_553 141
105 3300044765 Ga0466970_0033502 Ga0466970_0033502_597_1022 141
106 3300044842 Ga0466957_0001565 Ga0466957_0001565_226_651 141
107 3300044901 Ga0466960_0207299 Ga0466960_0207299_115_540 141
108 3300045976 Ga0466967_0058691 Ga0466967_0058691_1875_2300 141
109 3300061719 Ga0466962_0012797 Ga0466962_0012797_2640_3065 141
110 3300005327 Ga0070658_10015386 Ga0070658_100153866 142
111 3300013105 Ga0157369_10384327 Ga0157369_103843272 142
112 3300025909 Ga0207705_10023947 Ga0207705_100239473 142
113 3300031824 Ga0307413_10174074 Ga0307413_101740742 142
114 3300049571 Ga0501034_0551995 Ga0501034_0551995_173_601 142
115 3300003373 JGI25407J50210_10010946 JGI25407J50210_100109462 143
116 3300005435 Ga0070714_101103040 Ga0070714_1011030402 143
117 3300005981 Ga0081538_10024072 Ga0081538_100240722 143
118 3300005981 Ga0081538_10113845 Ga0081538_101138453 143
119 3300031824 Ga0307413_10931480 Ga0307413_109314802 143
120 3300031995 Ga0307409_100360937 Ga0307409_1003609372 143
121 3300032004 Ga0307414_11080981 Ga0307414_110809811 143
122 3300005981 Ga0081538_10095429 Ga0081538_100954293 144
123 3300039453 Ga0436362_0476620 Ga0436362_0476620_423_857 144
124 3300005366 Ga0070659_101298347 Ga0070659_1012983472 145
125 3300005981 Ga0081538_10001418 Ga0081538_1000141812 145
126 3300031548 Ga0307408_100220680 Ga0307408_1002206802 145
127 3300031824 Ga0307413_10339805 Ga0307413_103398052 145
128 3300031852 Ga0307410_10341129 Ga0307410_103411291 145
129 3300031903 Ga0307407_10374923 Ga0307407_103749231 145
130 3300031995 Ga0307409_100681569 Ga0307409_1006815691 145
131 3300031995 Ga0307409_100846003 Ga0307409_1008460031 145
132 3300032005 Ga0307411_10312029 Ga0307411_103120292 145
133 3300032126 Ga0307415_100033281 Ga0307415_1000332814 145
134 3300041413 Ga0439465_0018607 Ga0439465_0018607_1434_1871 145
135 3300041997 Ga0439431_0209522 Ga0439431_0209522_113_550 145
136 3300042005 Ga0439448_0043171 Ga0439448_0043171_819_1256 145
137 3300042016 Ga0439463_024176 Ga0439463_024176_48_485 145
138 3300042145 Ga0450906_053542 Ga0450906_053542_22_459 145
139 3300048914 Ga0496111_0042832 Ga0496111_0042832_2399_2836 145
140 3300049570 Ga0501033_0461269 Ga0501033_0461269_50_487 145
141 3300049575 Ga0501039_0439932 Ga0501039_0439932_50_487 145
142 3300009177 Ga0105248_11419593 Ga0105248_114195931 146
143 3300020080 Ga0206350_10548012 Ga0206350_105480122 146
144 3300022467 Ga0224712_10136103 Ga0224712_101361033 146
145 3300025922 Ga0207646_10673818 Ga0207646_106738182 146
146 3300026067 Ga0207678_10384356 Ga0207678_103843562 146
147 3300031903 Ga0307407_10455622 Ga0307407_104556221 146
148 3300031995 Ga0307409_100031408 Ga0307409_1000314082 146
149 3300032005 Ga0307411_11289858 Ga0307411_112898582 146
150 3300005578 Ga0068854_101609310 Ga0068854_1016093101 149
151 3300005719 Ga0068861_100168308 Ga0068861_1001683082 149
152 3300005981 Ga0081538_10056626 Ga0081538_100566264 149
153 3300013308 Ga0157375_11373796 Ga0157375_113737961 149
154 3300014745 Ga0157377_10315768 Ga0157377_103157681 149
155 3300014745 Ga0157377_10989071 Ga0157377_109890711 149
156 3300026118 Ga0207675_100057368 Ga0207675_1000573682 149
157 3300026121 Ga0207683_11225164 Ga0207683_112251641 149
158 3300044656 Ga0466969_0022266 Ga0466969_0022266_1767_2219 150
159 3300044684 Ga0466966_0383212 Ga0466966_0383212_234_686 150
160 3300045836 Ga0466958_0487944 Ga0466958_0487944_190_642 150
161 3300003373 JGI25407J50210_10004220 JGI25407J50210_100042203 153
162 3300003373 JGI25407J50210_10066529 JGI25407J50210_100665291 153
163 3300005981 Ga0081538_10005503 Ga0081538_100055037 153
164 3300005981 Ga0081538_10043569 Ga0081538_100435695 153
165 3300035119 Ga0373956_0000824 Ga0373956_0000824_10676_11140 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

31

157

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nb2-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus at 1.89 angstrom resolution - apo structure 0.8427 7 142
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8204 5 142
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.8174 7 142
1r9c-assembly1.cif.gz_B crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.8167 7 142
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8099 6 142
ID Description Score Start End Superfamily
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8621 7 142 3.10.180.10
af_O06633_2_115_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8552 7 142 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8275 13 143 3.10.180.10
2p7kA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8223 7 142 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8207 13 143 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A5P9QHF3-F1-model_v4 VOC domain-containing protein 0.9717 1 142
AF-B5HRT8-F1-model_v4 Glyoxalase 0.9688 4 142
AF-A0A840Q6V8-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9671 1 144 GO:0016829
GO:0051213
AF-A0A853AWS3-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9667 5 142 GO:0016829
GO:0051213
AF-A0A7Z0D803-F1-model_v4 Putative glyoxalase superfamily protein PhnB/catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9652 4 144 GO:0016829
GO:0051213

Feature Viewer

pLDDT pTM Quality
89.02 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map