F246817

General Info

Members Datasets Scaffolds Average Seq Length
165 96 330 337

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0122311|Ga0453684_0122311_1751_2866
Length 371
Sequence MVCGITIRAITAPQEALNWKKNKVTNSYQPVLELTRGQIVECIHFGAAAIVDEHGKLIASLGDPYLVTFLRSSAKPFQALPFIERGGHKKFGLIPREIALMCASHSGTDEHVETLKGMQAKIGINVDNLMCGTHYPMHEATADAMKVRGELPTPYRHNCSGKHTGMLAHAKLRGAPLENYIDFHHPVQESILEAFAAMCVIPAEKVELGIDGCSAPNFAIPLYNAALGYARLCDPRNQAPERAEACQIIASAMMTNPDMVGGPGRFDTALMQAGNGRILSKGGAEGFQAVGLLPGVLGPDSPGIGIAIKISDGDPTDRARNGVALAILQALGALTEAQLKQMSAFGPQVQLENFRKLKVGVSRPAFVLNKQ

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
46 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
47 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
48 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
49 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
50 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
51 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
54 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
55 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
56 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
63 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
64 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
65 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
66 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
67 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
71 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
75 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
76 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
77 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
78 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
79 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
80 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
81 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
82 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
83 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
84 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
85 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
86 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
87 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
88 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
89 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
95 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
96 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.79
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0122311 3300044712 Bacteria 3140
2 rootL2_10004648 3300003322 Unclassified 3163
3 Ga0070689_100006507 3300005340 Bacteria 8098
4 Ga0070688_100010746 3300005365 Bacteria 5059
5 Ga0070705_100012549 3300005440 Bacteria 4310
6 Ga0070694_100064052 3300005444 Bacteria 2516
7 Ga0070708_100003686 3300005445 Bacteria 12010
8 Ga0070681_10060505 3300005458 Bacteria 3764
9 Ga0068867_100350166 3300005459 Bacteria 1232
10 Ga0070685_10007699 3300005466 Bacteria 5512
11 Ga0070706_100168385 3300005467 Unclassified 2046
12 Ga0070706_100312091 3300005467 Bacteria 1467
13 Ga0070707_100047756 3300005468 Bacteria 4098
14 Ga0070707_100085308 3300005468 Bacteria 3052
15 Ga0070698_100012629 3300005471 Bacteria 8943
16 Ga0070698_100046278 3300005471 Bacteria 4448
17 Ga0070698_100077336 3300005471 Bacteria 3328
18 Ga0070698_100169083 3300005471 Bacteria 2128
19 Ga0070699_100009423 3300005518 Bacteria 8461
20 Ga0070699_100074709 3300005518 Bacteria 2949
21 Ga0070695_100070957 3300005545 Bacteria 2280
22 Ga0070695_100177224 3300005545 Bacteria 1508
23 Ga0070696_100011046 3300005546 Bacteria 6047
24 Ga0070696_100031198 3300005546 Bacteria 3652
25 Ga0070696_100057849 3300005546 Bacteria 2706
26 Ga0070696_100143744 3300005546 Bacteria 1746
27 Ga0070704_100004904 3300005549 Bacteria 7767
28 Ga0070664_100253563 3300005564 Bacteria 1582
29 Ga0068859_100000852 3300005617 Bacteria 31067
30 Ga0068864_100002743 3300005618 Bacteria 14513
31 Ga0068861_100014241 3300005719 Bacteria 5579
32 Ga0068858_100000299 3300005842 Bacteria 53338
33 Ga0068862_100040548 3300005844 Bacteria 3958
34 Ga0081539_10008230 3300005985 Bacteria 9166
35 Ga0075431_100044120 3300006847 Bacteria 4599
36 Ga0075433_10000021 3300006852 Bacteria 60563
37 Ga0075433_10014365 3300006852 Bacteria 6467
38 Ga0075433_10309373 3300006852 Unclassified 1398
39 Ga0075434_100002745 3300006871 Bacteria 15563
40 Ga0075434_100039025 3300006871 Bacteria 4705
41 Ga0075434_100138528 3300006871 Bacteria 2453
42 Ga0075436_100004240 3300006914 Bacteria 9840
43 Ga0097620_100000852 3300006931 Bacteria 31067
44 Ga0075435_100000107 3300007076 Bacteria 45455
45 Ga0111539_10005325 3300009094 Bacteria 16652
46 Ga0111539_10015919 3300009094 Bacteria 9341
47 Ga0111539_10155098 3300009094 Bacteria 2679
48 Ga0114129_10061703 3300009147 Bacteria 5239
49 Ga0105248_10017877 3300009177 Bacteria 7824
50 Ga0163163_10202189 3300014325 Bacteria 2035
51 Ga0157379_10002888 3300014968 Bacteria 14493
52 Ga0207653_10008119 3300025885 Bacteria 3271
53 Ga0207707_10022193 3300025912 Bacteria 5548
54 Ga0207646_10177680 3300025922 Bacteria 1923
55 Ga0207681_10110233 3300025923 Bacteria 2001
56 Ga0207711_10005227 3300025941 Bacteria 10999
57 Ga0207703_10001390 3300026035 Bacteria 22105
58 Ga0207675_100083463 3300026118 Bacteria 2996
59 Ga0207428_10034440 3300027907 Bacteria 4150
60 Ga0268265_10048737 3300028380 Bacteria 3182
61 Ga0316575_10010242 3300031665 Unclassified 3438
62 Ga0316579_10009290 3300031691 Bacteria 4133
63 Ga0316576_10059588 3300031727 Unclassified 2795
64 Ga0316576_10087487 3300031727 Unclassified 2319
65 Ga0316576_10142908 3300031727 Bacteria 1802
66 Ga0316578_10084123 3300031728 Unclassified 1895
67 Ga0316578_10195245 3300031728 Bacteria 1219
68 Ga0316577_10001652 3300031733 Bacteria 10665
69 Ga0316577_10003929 3300031733 Bacteria 7592
70 Ga0316577_10070194 3300031733 Bacteria 1956
71 Ga0316574_0000456 3300035398 Bacteria 16440
72 Ga0373933_0099057 3300035724 Bacteria 1807
73 Ga0373937_0037122 3300036401 Bacteria 4440
74 Ga0316582_0006324 3300036647 Bacteria 6209
75 Ga0316582_0070705 3300036647 Bacteria 2258
76 Ga0316582_0081073 3300036647 Bacteria 2119
77 Ga0316584_0044402 3300036712 Bacteria 3314
78 Ga0316584_0067196 3300036712 Bacteria 2687
79 Ga0400488_28796 3300038741 Unclassified 2009
80 Ga0439466_0059740 3300041411 Bacteria 1231
81 Ga0451577_0002353 3300042876 Bacteria 22733
82 Ga0451577_0011055 3300042876 Bacteria 8571
83 Ga0453683_0125052 3300044673 Unclassified 1619
84 Ga0453683_0278508 3300044673 Unclassified 1068
85 Ga0453684_0000074 3300044712 Bacteria 438364
86 Ga0453684_0000240 3300044712 Bacteria 235672
87 Ga0453684_0000670 3300044712 Bacteria 122645
88 Ga0453684_0001846 3300044712 Bacteria 55264
89 Ga0453684_0002815 3300044712 Bacteria 41104
90 Ga0453684_0003083 3300044712 Bacteria 38502
91 Ga0453684_0011456 3300044712 Bacteria 14868
92 Ga0453684_0012846 3300044712 Bacteria 13722
93 Ga0453684_0019643 3300044712 Bacteria 10267
94 Ga0453684_0118436 3300044712 Bacteria 3202
95 Ga0453684_0248988 3300044712 Bacteria 2041
96 Ga0453684_0340759 3300044712 Unclassified 1693
97 Ga0453684_0473793 3300044712 Bacteria 1390
98 Ga0453684_0603028 3300044712 Bacteria 1203
99 Ga0451576_0000187 3300045051 Bacteria 155783
100 Ga0451576_0005844 3300045051 Bacteria 15281
101 Ga0451576_0016318 3300045051 Bacteria 8201
102 Ga0451576_0233685 3300045051 Bacteria 1920
103 Ga0451576_0403646 3300045051 Bacteria 1433
104 Ga0495582_0001492 3300046473 Bacteria 13238
105 Ga0495594_0047265 3300046499 Bacteria 2363
106 Ga0495659_0001283 3300046664 Bacteria 8639
107 Ga0495588_0004106 3300046674 Bacteria 6408
108 Ga0495658_0000801 3300046683 Bacteria 16912
109 Ga0495658_0016505 3300046683 Bacteria 3800
110 Ga0495676_0078838 3300047321 Bacteria 2506
111 Ga0501031_0004859 3300049568 Bacteria 8735
112 Ga0501031_0120906 3300049568 Bacteria 1711
113 Ga0501036_0022118 3300049572 Bacteria 5348
114 Ga0501038_0099343 3300049574 Bacteria 2426
115 Ga0501039_0015939 3300049575 Bacteria 5754
116 Ga0501040_0013132 3300049576 Bacteria 5447
117 Ga0501040_0141443 3300049576 Unclassified 1695
118 Ga0501042_0005437 3300049578 Bacteria 8204
119 Ga0501046_0109174 3300049580 Bacteria 2115
120 Ga0501048_0117408 3300049582 Bacteria 1879
121 Ga0501068_0007336 3300049584 Bacteria 6106
122 Ga0501068_0069163 3300049584 Bacteria 2153
123 Ga0501069_0023220 3300049585 Bacteria 3380
124 Ga0501069_0055508 3300049585 Unclassified 2207
125 Ga0501070_0260151 3300049586 Bacteria 1418
126 Ga0501071_0013680 3300049587 Bacteria 5534
127 Ga0501071_0019760 3300049587 Bacteria 4676
128 Ga0501071_0169404 3300049587 Bacteria 1635
129 Ga0501072_0010638 3300049588 Bacteria 7007
130 Ga0501072_0027408 3300049588 Bacteria 4444
131 Ga0501072_0039774 3300049588 Bacteria 3692
132 Ga0501072_0101408 3300049588 Bacteria 2288
133 Ga0501074_0012829 3300049590 Bacteria 6092
134 Ga0501075_0258820 3300049591 Unclassified 1326
135 Ga0501075_0320095 3300049591 Bacteria 1182
136 Ga0501076_0001274 3300049592 Bacteria 16797
137 Ga0501077_0014688 3300049593 Bacteria 4921
138 Ga0501079_0019886 3300049741 Bacteria 5129
139 Ga0501079_0083024 3300049741 Bacteria 2478
140 Ga0501079_0434795 3300049741 Bacteria 1030
141 Ga0501080_0006840 3300049742 Bacteria 10284
142 Ga0501080_0135273 3300049742 Bacteria 2281
143 Ga0501081_0053152 3300049743 Bacteria 2796
144 Ga0501081_0075886 3300049743 Bacteria 2347
145 Ga0501081_0219333 3300049743 Bacteria 1383
146 Ga0501045_0030134 3300049824 Bacteria 3925
147 nmdc:mga09592_173825_c2 3300050508 Bacteria 1539
148 nmdc:mga06r32_22949_c1 3300050510 Bacteria 5771
149 nmdc:mga08y16_100981_c1 3300050511 Bacteria 3003
150 nmdc:mga08y16_5726_c1 3300050511 Bacteria 13023
151 nmdc:mga0n895_374138_c1 3300050512 Unclassified 1442
152 nmdc:mga0n895_789_c1 3300050512 Bacteria 22597
153 nmdc:mga0rr50_120957_c1 3300050513 Bacteria 2084
154 nmdc:mga0rr50_199_c1 3300050513 Bacteria 32701
155 nmdc:mga08x19_167853_c1 3300050514 Bacteria 1493
156 nmdc:mga08x19_40757_c1 3300050514 Bacteria 2956
157 nmdc:mga08x19_4985_c1 3300050514 Bacteria 7849
158 nmdc:mga0a205_186074_c1 3300050515 Bacteria 1970
159 nmdc:mga0a205_52299_c1 3300050515 Bacteria 3942
160 nmdc:mga0a205_83_c1 3300050515 Bacteria 52257
161 Ga0501084_0036731 3300054114 Bacteria 4093
162 Ga0501084_0125844 3300054114 Bacteria 2156
163 Ga0501082_0005552 3300060353 Bacteria 10952
164 Ga0530510_0006360 3300061734 Bacteria 8218
165 Ga0530510_0205669 3300061734 Bacteria 1463
166 Ga0453684_0122311
167 rootL2_10004648
168 Ga0070689_100006507
169 Ga0070688_100010746
170 Ga0070705_100012549
171 Ga0070694_100064052
172 Ga0070708_100003686
173 Ga0070681_10060505
174 Ga0068867_100350166
175 Ga0070685_10007699
176 Ga0070706_100168385
177 Ga0070706_100312091
178 Ga0070707_100047756
179 Ga0070707_100085308
180 Ga0070698_100012629
181 Ga0070698_100046278
182 Ga0070698_100077336
183 Ga0070698_100169083
184 Ga0070699_100009423
185 Ga0070699_100074709
186 Ga0070695_100070957
187 Ga0070695_100177224
188 Ga0070696_100011046
189 Ga0070696_100031198
190 Ga0070696_100057849
191 Ga0070696_100143744
192 Ga0070704_100004904
193 Ga0070664_100253563
194 Ga0068859_100000852
195 Ga0068864_100002743
196 Ga0068861_100014241
197 Ga0068858_100000299
198 Ga0068862_100040548
199 Ga0081539_10008230
200 Ga0075431_100044120
201 Ga0075433_10000021
202 Ga0075433_10014365
203 Ga0075433_10309373
204 Ga0075434_100002745
205 Ga0075434_100039025
206 Ga0075434_100138528
207 Ga0075436_100004240
208 Ga0097620_100000852
209 Ga0075435_100000107
210 Ga0111539_10005325
211 Ga0111539_10015919
212 Ga0111539_10155098
213 Ga0114129_10061703
214 Ga0105248_10017877
215 Ga0163163_10202189
216 Ga0157379_10002888
217 Ga0207653_10008119
218 Ga0207707_10022193
219 Ga0207646_10177680
220 Ga0207681_10110233
221 Ga0207711_10005227
222 Ga0207703_10001390
223 Ga0207675_100083463
224 Ga0207428_10034440
225 Ga0268265_10048737
226 Ga0316575_10010242
227 Ga0316579_10009290
228 Ga0316576_10059588
229 Ga0316576_10087487
230 Ga0316576_10142908
231 Ga0316578_10084123
232 Ga0316578_10195245
233 Ga0316577_10001652
234 Ga0316577_10003929
235 Ga0316577_10070194
236 Ga0316574_0000456
237 Ga0373933_0099057
238 Ga0373937_0037122
239 Ga0316582_0006324
240 Ga0316582_0070705
241 Ga0316582_0081073
242 Ga0316584_0044402
243 Ga0316584_0067196
244 Ga0400488_28796
245 Ga0439466_0059740
246 Ga0451577_0002353
247 Ga0451577_0011055
248 Ga0453683_0125052
249 Ga0453683_0278508
250 Ga0453684_0000074
251 Ga0453684_0000240
252 Ga0453684_0000670
253 Ga0453684_0001846
254 Ga0453684_0002815
255 Ga0453684_0003083
256 Ga0453684_0011456
257 Ga0453684_0012846
258 Ga0453684_0019643
259 Ga0453684_0118436
260 Ga0453684_0248988
261 Ga0453684_0340759
262 Ga0453684_0473793
263 Ga0453684_0603028
264 Ga0451576_0000187
265 Ga0451576_0005844
266 Ga0451576_0016318
267 Ga0451576_0233685
268 Ga0451576_0403646
269 Ga0495582_0001492
270 Ga0495594_0047265
271 Ga0495659_0001283
272 Ga0495588_0004106
273 Ga0495658_0000801
274 Ga0495658_0016505
275 Ga0495676_0078838
276 Ga0501031_0004859
277 Ga0501031_0120906
278 Ga0501036_0022118
279 Ga0501038_0099343
280 Ga0501039_0015939
281 Ga0501040_0013132
282 Ga0501040_0141443
283 Ga0501042_0005437
284 Ga0501046_0109174
285 Ga0501048_0117408
286 Ga0501068_0007336
287 Ga0501068_0069163
288 Ga0501069_0023220
289 Ga0501069_0055508
290 Ga0501070_0260151
291 Ga0501071_0013680
292 Ga0501071_0019760
293 Ga0501071_0169404
294 Ga0501072_0010638
295 Ga0501072_0027408
296 Ga0501072_0039774
297 Ga0501072_0101408
298 Ga0501074_0012829
299 Ga0501075_0258820
300 Ga0501075_0320095
301 Ga0501076_0001274
302 Ga0501077_0014688
303 Ga0501079_0019886
304 Ga0501079_0083024
305 Ga0501079_0434795
306 Ga0501080_0006840
307 Ga0501080_0135273
308 Ga0501081_0053152
309 Ga0501081_0075886
310 Ga0501081_0219333
311 Ga0501045_0030134
312 nmdc:mga09592_173825_c2
313 nmdc:mga06r32_22949_c1
314 nmdc:mga08y16_100981_c1
315 nmdc:mga08y16_5726_c1
316 nmdc:mga0n895_374138_c1
317 nmdc:mga0n895_789_c1
318 nmdc:mga0rr50_120957_c1
319 nmdc:mga0rr50_199_c1
320 nmdc:mga08x19_167853_c1
321 nmdc:mga08x19_40757_c1
322 nmdc:mga08x19_4985_c1
323 nmdc:mga0a205_186074_c1
324 nmdc:mga0a205_52299_c1
325 nmdc:mga0a205_83_c1
326 Ga0501084_0036731
327 Ga0501084_0125844
328 Ga0501082_0005552
329 Ga0530510_0006360
330 Ga0530510_0205669

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06089

Asparaginase_II

L-asparaginase II

32

364

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9181 2 328
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9177 2 328
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9073 2 328
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9069 2 328
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9036 2 328
ID Description Score Start End Superfamily
af_A0A1D6ED35_71_216_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.768 142 184 3.30.70.330
af_Q8SXB3_7_108_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.7525 143 173 3.90.470.20
af_P52060_1_96_3.30.1200.10 Alpha Beta;2-Layer Sandwich;Conserved Hypothetical Protein Mth637; Chain: A;;YggU-like 0.6856 142 176 3.30.1200.10
af_A0A1D6E3G2_345_488_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6352 147 187 3.30.70.330
af_A0A286YB57_126_199_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6295 144 184 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A535C930-F1-model_v4 Asparaginase 0.99 28 325
AF-A0A535C930-F1-model_v4 Asparaginase 0.9867 28 325
AF-A0A534ZUB4-F1-model_v4 Asparaginase 0.9866 2 325
AF-A0A6L8UU33-F1-model_v4 Asparaginase 0.9813 2 324
AF-A0A354HQ50-F1-model_v4 L-asparaginase 0.9808 2 328

Map