F246670

General Info

Members Datasets Scaffolds Average Seq Length
165 136 330 92

Family's Representative Sequence

Representative Sequence 3300038735|Ga0400485_03076|Ga0400485_03076_379_705
Length 108
Sequence VCNKRVDSVTEVDTIHGMIKSFRHKGLAELFTRGHSRKVRQNLQSRSLRRLDALDQAESLTDMNVPGFNFHGLQGKPKRYSIHVNGPWCITFEWEDGDALRVDLEQYH

Samples

Sample ID Description Type Environment
1 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
45 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
64 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
65 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
66 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
69 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
70 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
71 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
76 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
82 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
83 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
84 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
85 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 1.82
Rhizosphere 82.42
Stem 0
Stem Tuber 0
Unclassified 24.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400485_03076 3300038735 Bacteria 1799
2 JGI25165J46597_1003318 3300003214 Bacteria 4107
3 Ga0070677_10758002 3300005333 Bacteria 551
4 Ga0070660_100131308 3300005339 Bacteria 2004
5 Ga0070659_100312710 3300005366 Bacteria 1312
6 Ga0070709_10247728 3300005434 Bacteria 1282
7 Ga0070714_101943426 3300005435 Unclassified 574
8 Ga0070713_100126374 3300005436 Bacteria 2250
9 Ga0070700_100702602 3300005441 Bacteria 804
10 Ga0070708_100736188 3300005445 Bacteria 927
11 Ga0070663_100165899 3300005455 Bacteria 1703
12 Ga0070663_101254898 3300005455 Unclassified 653
13 Ga0070681_10436936 3300005458 Bacteria 1221
14 Ga0068867_100353033 3300005459 Bacteria 1228
15 Ga0070706_101625640 3300005467 Unclassified 589
16 Ga0070679_100190171 3300005530 Bacteria 2022
17 Ga0070679_100473851 3300005530 Unclassified 1196
18 Ga0070697_101781824 3300005536 Bacteria 551
19 Ga0068855_100126835 3300005563 Bacteria 2917
20 Ga0068857_101648720 3300005577 Bacteria 626
21 Ga0068854_100000740 3300005578 Bacteria 19367
22 Ga0070702_100176798 3300005615 Bacteria 1393
23 Ga0068858_100342364 3300005842 Bacteria 1431
24 Ga0068860_100308168 3300005843 Bacteria 1552
25 Ga0068862_101369453 3300005844 Bacteria 710
26 Ga0081455_10016493 3300005937 Bacteria 7129
27 Ga0081538_10026375 3300005981 Bacteria 4065
28 Ga0081538_10166295 3300005981 Unclassified 970
29 Ga0070712_100323762 3300006175 Bacteria 1254
30 Ga0075366_10392422 3300006195 Unclassified 854
31 Ga0075428_100907383 3300006844 Bacteria 934
32 Ga0075433_10207565 3300006852 Bacteria 1741
33 Ga0075434_100017467 3300006871 Bacteria 6914
34 Ga0068865_100410842 3300006881 Bacteria 1111
35 Ga0075435_100972673 3300007076 Bacteria 741
36 Ga0105240_10484534 3300009093 Unclassified 1378
37 Ga0114129_10283747 3300009147 Bacteria 2212
38 Ga0114129_11134311 3300009147 Bacteria 977
39 Ga0105241_11339118 3300009174 Bacteria 683
40 Ga0105238_10180436 3300009551 Bacteria 2088
41 Ga0105239_10009560 3300010375 Bacteria 10909
42 Ga0105239_10923670 3300010375 Bacteria 1002
43 Ga0157371_10204349 3300013102 Unclassified 1417
44 Ga0157370_10191382 3300013104 Bacteria 1899
45 Ga0157370_10444159 3300013104 Unclassified 1193
46 Ga0157374_10030115 3300013296 Bacteria 4925
47 Ga0157378_11642196 3300013297 Unclassified 689
48 Ga0157372_10702032 3300013307 Bacteria 1177
49 Ga0213876_10025157 3300021384 Unclassified 3142
50 Ga0207427_104570 3300025231 Bacteria 2270
51 Ga0209233_1001475 3300025261 Bacteria 9278
52 Ga0207699_10193425 3300025906 Bacteria 1374
53 Ga0207699_10351527 3300025906 Bacteria 1041
54 Ga0207705_10022167 3300025909 Bacteria 4531
55 Ga0207684_10662240 3300025910 Unclassified 889
56 Ga0207707_10397653 3300025912 Bacteria 1183
57 Ga0207707_10638773 3300025912 Bacteria 898
58 Ga0207695_10425897 3300025913 Unclassified 1211
59 Ga0207693_10190406 3300025915 Bacteria 1614
60 Ga0207657_10006065 3300025919 Bacteria 12571
61 Ga0207652_10293818 3300025921 Bacteria 1466
62 Ga0207694_10542600 3300025924 Bacteria 975
63 Ga0207700_10053805 3300025928 Bacteria 3018
64 Ga0207667_11091451 3300025949 Unclassified 782
65 Ga0207640_10000651 3300025981 Bacteria 20290
66 Ga0207678_10029448 3300026067 Bacteria 4792
67 Ga0207678_11241572 3300026067 Unclassified 660
68 Ga0207674_11441438 3300026116 Bacteria 658
69 Ga0268264_10176251 3300028381 Bacteria 1938
70 Ga0265340_10013765 3300031247 Bacteria 4242
71 Ga0265327_10003516 3300031251 Bacteria 14866
72 Ga0265327_10006573 3300031251 Bacteria 9243
73 Ga0265327_10072821 3300031251 Unclassified 1715
74 Ga0316579_10065215 3300031691 Unclassified 1718
75 Ga0316576_10014372 3300031727 Bacteria 5289
76 Ga0316576_10168766 3300031727 Bacteria 1651
77 Ga0316576_10352346 3300031727 Bacteria 1095
78 Ga0316578_10525258 3300031728 Bacteria 696
79 Ga0316577_10060153 3300031733 Unclassified 2120
80 Ga0316577_10212613 3300031733 Unclassified 1093
81 Ga0307411_12166086 3300032005 Unclassified 521
82 Ga0316585_10004998 3300032137 Bacteria 3729
83 Ga0316580_10010280 3300032139 Bacteria 2824
84 Ga0373955_1044450 3300035172 Unclassified 503
85 Ga0316574_0243061 3300035398 Unclassified 1150
86 Ga0373924_0303422 3300035410 Unclassified 709
87 Ga0373935_0772259 3300035692 Bacteria 709
88 Ga0373947_0134117 3300035725 Plasmid 1583
89 Ga0316582_0087260 3300036647 Bacteria 2047
90 Ga0316582_0127565 3300036647 Bacteria 1706
91 Ga0316584_0128011 3300036712 Unclassified 1896
92 Ga0395900_0154645 3300037418 Bacteria 2343
93 Ga0395900_1716631 3300037418 Unclassified 539
94 Ga0395898_0001253 3300037466 Bacteria 37794
95 Ga0395901_0000682 3300038443 Bacteria 38923
96 Ga0395901_0741844 3300038443 Bacteria 976
97 Ga0400484_34831 3300038725 Bacteria 4291
98 Ga0400491_29649 3300038727 Bacteria 1170
99 Ga0400486_11878 3300038742 Bacteria 1665
100 Ga0400483_142440 3300039062 Viruses 3631
101 Ga0400483_214186 3300039062 Bacteria 1963
102 Ga0400483_278047 3300039062 Bacteria 2892
103 Ga0400489_83487 3300039093 Bacteria 1101
104 Ga0400487_15208 3300039110 Bacteria 2718
105 Ga0436365_0692474 3300039437 Unclassified 2039
106 Ga0436365_1889759 3300039437 Unclassified 3207
107 Ga0451807_1932479 3300041486 Bacteria 1851
108 Ga0451853_1355218 3300041512 Unclassified 531
109 Ga0466965_0705385 3300044683 Unclassified 579
110 Ga0453684_0021679 3300044712 Bacteria 9581
111 Ga0495603_0416012 3300046455 Unclassified 770
112 Ga0495580_0211256 3300046472 Bacteria 1335
113 Ga0495582_0037538 3300046473 Bacteria 2665
114 Ga0495630_0628695 3300046517 Unclassified 822
115 Ga0495666_0261661 3300046526 Unclassified 787
116 Ga0495587_0440801 3300046536 Unclassified 722
117 Ga0495647_0183017 3300046681 Plasmid 912
118 Ga0495658_0025759 3300046683 Bacteria 3147
119 Ga0495581_0667960 3300047315 Unclassified 600
120 Ga0495674_0357783 3300047319 Unclassified 1184
121 Ga0496114_0180961 3300048917 Unclassified 1841
122 Ga0496115_0000062 3300048918 Bacteria 100189
123 Ga0496125_0614200 3300048928 Bacteria 591
124 Ga0496126_0000057 3300048929 Bacteria 276781
125 Ga0501033_0550538 3300049570 Unclassified 795
126 Ga0501034_0069917 3300049571 Bacteria 3522
127 Ga0501036_0695355 3300049572 Bacteria 840
128 Ga0501037_1056350 3300049573 Bacteria 527
129 Ga0501039_0662266 3300049575 Unclassified 817
130 Ga0501043_0028910 3300049579 Bacteria 4351
131 Ga0501046_0028335 3300049580 Bacteria 4562
132 Ga0501047_0104419 3300049581 Bacteria 2713
133 Ga0501047_0315810 3300049581 Bacteria 1403
134 Ga0501047_0447566 3300049581 Bacteria 1121
135 Ga0501069_0440219 3300049585 Bacteria 774
136 Ga0501070_1468805 3300049586 Bacteria 516
137 Ga0501072_1435704 3300049588 Bacteria 533
138 Ga0501073_0442913 3300049589 Bacteria 898
139 Ga0501074_0015939 3300049590 Bacteria 5466
140 Ga0501074_0275862 3300049590 Bacteria 1195
141 Ga0501075_0130731 3300049591 Bacteria 1913
142 Ga0501079_0362011 3300049741 Bacteria 1137
143 Ga0501080_0000739 3300049742 Bacteria 26414
144 Ga0501080_0024328 3300049742 Bacteria 5615
145 Ga0501081_0518809 3300049743 Bacteria 889
146 Ga0501081_1536116 3300049743 Bacteria 506
147 Ga0501035_0546672 3300049822 Bacteria 949
148 Ga0501044_0365614 3300049823 Bacteria 1360
149 Ga0501044_0490398 3300049823 Bacteria 1131
150 Ga0501044_1487232 3300049823 Bacteria 542
151 nmdc:mga05p37_220204_c1 3300050507 Bacteria 2291
152 nmdc:mga05p37_224134_c1 3300050507 Bacteria 2268
153 nmdc:mga09592_366009_c1 3300050508 Bacteria 1247
154 nmdc:mga0qj67_595734_c1 3300050509 Bacteria 884
155 nmdc:mga0n895_17843_c1 3300050512 Bacteria 6553
156 nmdc:mga0a205_232162_c1 3300050515 Bacteria 1728
157 Ga0500566_0293774 3300053094 Unclassified 768
158 Ga0500556_0001176 3300053104 Bacteria 12495
159 Ga0500577_0509192 3300053142 Bacteria 526
160 Ga0500616_0003028 3300053153 Bacteria 13241
161 Ga0500622_0209129 3300053156 Bacteria 882
162 Ga0500645_000512 3300053730 Bacteria 26038
163 Ga0500645_099220 3300053730 Unclassified 822
164 Ga0501084_0160011 3300054114 Bacteria 1900
165 Ga0501082_0409945 3300060353 Bacteria 1183
166 Ga0400485_03076
167 JGI25165J46597_1003318
168 Ga0070677_10758002
169 Ga0070660_100131308
170 Ga0070659_100312710
171 Ga0070709_10247728
172 Ga0070714_101943426
173 Ga0070713_100126374
174 Ga0070700_100702602
175 Ga0070708_100736188
176 Ga0070663_100165899
177 Ga0070663_101254898
178 Ga0070681_10436936
179 Ga0068867_100353033
180 Ga0070706_101625640
181 Ga0070679_100190171
182 Ga0070679_100473851
183 Ga0070697_101781824
184 Ga0068855_100126835
185 Ga0068857_101648720
186 Ga0068854_100000740
187 Ga0070702_100176798
188 Ga0068858_100342364
189 Ga0068860_100308168
190 Ga0068862_101369453
191 Ga0081455_10016493
192 Ga0081538_10026375
193 Ga0081538_10166295
194 Ga0070712_100323762
195 Ga0075366_10392422
196 Ga0075428_100907383
197 Ga0075433_10207565
198 Ga0075434_100017467
199 Ga0068865_100410842
200 Ga0075435_100972673
201 Ga0105240_10484534
202 Ga0114129_10283747
203 Ga0114129_11134311
204 Ga0105241_11339118
205 Ga0105238_10180436
206 Ga0105239_10009560
207 Ga0105239_10923670
208 Ga0157371_10204349
209 Ga0157370_10191382
210 Ga0157370_10444159
211 Ga0157374_10030115
212 Ga0157378_11642196
213 Ga0157372_10702032
214 Ga0213876_10025157
215 Ga0207427_104570
216 Ga0209233_1001475
217 Ga0207699_10193425
218 Ga0207699_10351527
219 Ga0207705_10022167
220 Ga0207684_10662240
221 Ga0207707_10397653
222 Ga0207707_10638773
223 Ga0207695_10425897
224 Ga0207693_10190406
225 Ga0207657_10006065
226 Ga0207652_10293818
227 Ga0207694_10542600
228 Ga0207700_10053805
229 Ga0207667_11091451
230 Ga0207640_10000651
231 Ga0207678_10029448
232 Ga0207678_11241572
233 Ga0207674_11441438
234 Ga0268264_10176251
235 Ga0265340_10013765
236 Ga0265327_10003516
237 Ga0265327_10006573
238 Ga0265327_10072821
239 Ga0316579_10065215
240 Ga0316576_10014372
241 Ga0316576_10168766
242 Ga0316576_10352346
243 Ga0316578_10525258
244 Ga0316577_10060153
245 Ga0316577_10212613
246 Ga0307411_12166086
247 Ga0316585_10004998
248 Ga0316580_10010280
249 Ga0373955_1044450
250 Ga0316574_0243061
251 Ga0373924_0303422
252 Ga0373935_0772259
253 Ga0373947_0134117
254 Ga0316582_0087260
255 Ga0316582_0127565
256 Ga0316584_0128011
257 Ga0395900_0154645
258 Ga0395900_1716631
259 Ga0395898_0001253
260 Ga0395901_0000682
261 Ga0395901_0741844
262 Ga0400484_34831
263 Ga0400491_29649
264 Ga0400486_11878
265 Ga0400483_142440
266 Ga0400483_214186
267 Ga0400483_278047
268 Ga0400489_83487
269 Ga0400487_15208
270 Ga0436365_0692474
271 Ga0436365_1889759
272 Ga0451807_1932479
273 Ga0451853_1355218
274 Ga0466965_0705385
275 Ga0453684_0021679
276 Ga0495603_0416012
277 Ga0495580_0211256
278 Ga0495582_0037538
279 Ga0495630_0628695
280 Ga0495666_0261661
281 Ga0495587_0440801
282 Ga0495647_0183017
283 Ga0495658_0025759
284 Ga0495581_0667960
285 Ga0495674_0357783
286 Ga0496114_0180961
287 Ga0496115_0000062
288 Ga0496125_0614200
289 Ga0496126_0000057
290 Ga0501033_0550538
291 Ga0501034_0069917
292 Ga0501036_0695355
293 Ga0501037_1056350
294 Ga0501039_0662266
295 Ga0501043_0028910
296 Ga0501046_0028335
297 Ga0501047_0104419
298 Ga0501047_0315810
299 Ga0501047_0447566
300 Ga0501069_0440219
301 Ga0501070_1468805
302 Ga0501072_1435704
303 Ga0501073_0442913
304 Ga0501074_0015939
305 Ga0501074_0275862
306 Ga0501075_0130731
307 Ga0501079_0362011
308 Ga0501080_0000739
309 Ga0501080_0024328
310 Ga0501081_0518809
311 Ga0501081_1536116
312 Ga0501035_0546672
313 Ga0501044_0365614
314 Ga0501044_0490398
315 Ga0501044_1487232
316 nmdc:mga05p37_220204_c1
317 nmdc:mga05p37_224134_c1
318 nmdc:mga09592_366009_c1
319 nmdc:mga0qj67_595734_c1
320 nmdc:mga0n895_17843_c1
321 nmdc:mga0a205_232162_c1
322 Ga0500566_0293774
323 Ga0500556_0001176
324 Ga0500577_0509192
325 Ga0500616_0003028
326 Ga0500622_0209129
327 Ga0500645_000512
328 Ga0500645_099220
329 Ga0501084_0160011
330 Ga0501082_0409945

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

20

108

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9533 1 92
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9533 1 91
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.9508 1 92
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9497 1 92
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9433 1 92
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9484 1 92 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9386 1 92 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.938 3 89 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9083 3 89 3.30.2310.20
af_Q58319_5_91_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.7328 1 90 3.30.2310.20
ID Description Score Start End GO Terms
AF-A0A1H7VNR2-F1-model_v4 Proteic killer suppression protein 1.006 27 92
AF-A0A0M4LRK3-F1-model_v4 HigB toxin protein 0.9911 2 92
AF-A0A4V2V3Y6-F1-model_v4 Proteic killer suppression protein 0.9901 1 92
AF-A0A4Q3YP81-F1-model_v4 Plasmid maintenance system killer 0.9893 1 68
AF-A0A8B2NJD7-F1-model_v4 Plasmid maintenance system killer 0.9889 2 92

Map