F246445

General Info

Members Datasets Scaffolds Average Seq Length
165 125 330 451

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10177905|Ga0307515_101779052
Length 489
Sequence MAADVVTTKKSSKTNATPVKAAKAKTNGSSGGAKSKVHDRHLFGTDGIRGMANEPPMTPELALALGKAVAYVAGRNKSHTPRLLIGKDTRLSGYMIEQAIAAGICSMGGRVILCGPLPTPAVAQLTVSMRADAGIVISASHNPYQDNGIKIFGADGFKLPDSEEAEIERLMGNDALLGPRPTGPGIGKALRLDDAGGRYVVFAKATFPRGLALDNVRVVVDAAHGAAYKVAPLVFSELGATVTAIGVKPTGTNINRDAGALAPDNVRAEVVKRGAQMGIALDGDADRLIVIDEKGQIVDGDVVMAMCASRMLDDGQLAKKTLVATVMSNLGLERAMQARGGKLVRTQVGDRYVVEAMRGNGYNLGGEQSGHLIFLDHASTGDGIVAALQVLAIMVRTGRPLSELAKEAMVRVPQVLENVTLSARQPLEQMRNLSLGTAKVKDALGADGRVLVRWSGTEAKLRIMLEGPDEDRLRTWAKDLAAAAKKDVP

Samples

Sample ID Description Type Environment
1 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
65 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
70 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
73 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
74 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
92 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
93 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
98 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
99 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
100 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
101 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
104 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
107 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
108 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
109 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
110 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
113 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
114 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
115 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
116 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
121 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
122 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
123 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.91
Nodule 0
Rhizoplane 0.61
Rhizosphere 82.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307515_10177905 3300028794 Bacteria 2090
2 Ga0070683_100062245 3300005329 Bacteria 3470
3 Ga0070670_100037250 3300005331 Bacteria 4185
4 Ga0068869_100035874 3300005334 Bacteria 3518
5 Ga0068869_100047851 3300005334 Bacteria 3090
6 Ga0070689_100052508 3300005340 Bacteria 3153
7 Ga0070675_100047823 3300005354 Bacteria 3506
8 Ga0070675_100083742 3300005354 Bacteria 2663
9 Ga0070674_100080988 3300005356 Bacteria 2319
10 Ga0070673_100019799 3300005364 Bacteria 4839
11 Ga0070688_100072941 3300005365 Bacteria 2201
12 Ga0070703_10008096 3300005406 Bacteria 2954
13 Ga0070701_10013243 3300005438 Bacteria 3747
14 Ga0070705_100157639 3300005440 Bacteria 1514
15 Ga0070678_100046291 3300005456 Bacteria 3118
16 Ga0070678_100115497 3300005456 Bacteria 2107
17 Ga0070706_100003300 3300005467 Bacteria 15962
18 Ga0070706_100078960 3300005467 Bacteria 3046
19 Ga0070706_100132839 3300005467 Bacteria 2323
20 Ga0070707_100003559 3300005468 Bacteria 14700
21 Ga0070707_100074795 3300005468 Bacteria 3267
22 Ga0070698_100001430 3300005471 Bacteria 26450
23 Ga0070698_100081847 3300005471 Bacteria 3222
24 Ga0070698_100183158 3300005471 Bacteria 2032
25 Ga0070686_100115504 3300005544 Bacteria 1835
26 Ga0070695_100041219 3300005545 Bacteria 2926
27 Ga0070696_100022188 3300005546 Bacteria 4312
28 Ga0068859_100015390 3300005617 Bacteria 7685
29 Ga0068861_100002550 3300005719 Bacteria 11910
30 Ga0068863_100114228 3300005841 Bacteria 2572
31 Ga0068862_100050440 3300005844 Bacteria 3557
32 Ga0081455_10119888 3300005937 Bacteria 2074
33 Ga0070717_10017222 3300006028 Bacteria 5617
34 Ga0068871_100050510 3300006358 Bacteria 3364
35 Ga0075428_100005342 3300006844 Bacteria 14283
36 Ga0075431_100156310 3300006847 Bacteria 2346
37 Ga0075433_10008313 3300006852 Bacteria 8274
38 Ga0075434_100041686 3300006871 Bacteria 4548
39 Ga0075429_100024943 3300006880 Bacteria 5191
40 Ga0075429_100067705 3300006880 Bacteria 3107
41 Ga0097620_100015390 3300006931 Bacteria 7685
42 Ga0075435_100031357 3300007076 Bacteria 4186
43 Ga0105245_10000032 3300009098 Bacteria 150103
44 Ga0114129_10302788 3300009147 Bacteria 2130
45 Ga0105248_10097710 3300009177 Bacteria 3308
46 Ga0105249_10110698 3300009553 Bacteria 2595
47 Ga0157374_10013959 3300013296 Bacteria 7021
48 Ga0157378_10074055 3300013297 Bacteria 3064
49 Ga0163163_10055134 3300014325 Bacteria 3929
50 Ga0207653_10006504 3300025885 Bacteria 3647
51 Ga0207684_10041827 3300025910 Bacteria 3884
52 Ga0207652_10040409 3300025921 Bacteria 3961
53 Ga0207646_10020013 3300025922 Bacteria 6208
54 Ga0207646_10068811 3300025922 Bacteria 3162
55 Ga0207650_10048961 3300025925 Bacteria 3119
56 Ga0207659_10017056 3300025926 Bacteria 4738
57 Ga0207659_10038670 3300025926 Bacteria 3321
58 Ga0207687_10000066 3300025927 Bacteria 80190
59 Ga0207669_10069404 3300025937 Bacteria 2205
60 Ga0207691_10119278 3300025940 Bacteria 2339
61 Ga0207689_10031896 3300025942 Bacteria 4382
62 Ga0207689_10040628 3300025942 Bacteria 3849
63 Ga0207661_10083600 3300025944 Bacteria 2642
64 Ga0207678_10020991 3300026067 Bacteria 5724
65 Ga0207702_10121875 3300026078 Bacteria 2335
66 Ga0207702_10201519 3300026078 Bacteria 1845
67 Ga0207641_10027088 3300026088 Bacteria 4733
68 Ga0207641_10262459 3300026088 Bacteria 1618
69 Ga0207675_100002786 3300026118 Bacteria 17178
70 Ga0207683_10037792 3300026121 Bacteria 4206
71 Ga0207683_10043588 3300026121 Bacteria 3921
72 Ga0268266_10004475 3300028379 Bacteria 13363
73 Ga0268266_10028376 3300028379 Bacteria 4758
74 Ga0268265_10087255 3300028380 Bacteria 2482
75 Ga0307517_10050560 3300028786 Bacteria 4222
76 Ga0307515_10000701 3300028794 Bacteria 77463
77 Ga0265332_10013193 3300031238 Bacteria 3663
78 Ga0307513_10004906 3300031456 Bacteria 17764
79 Ga0307509_10000007 3300031507 Bacteria 409278
80 Ga0307509_10003065 3300031507 Bacteria 25949
81 Ga0307509_10114604 3300031507 Bacteria 2690
82 Ga0307509_10136497 3300031507 Bacteria 2397
83 Ga0316576_10003857 3300031727 Bacteria 8882
84 Ga0316576_10009641 3300031727 Bacteria 6245
85 Ga0316578_10005309 3300031728 Bacteria 6229
86 Ga0316578_10008752 3300031728 Bacteria 5170
87 Ga0307516_10041444 3300031730 Bacteria 4576
88 Ga0307406_10040220 3300031901 Bacteria 2906
89 Ga0307407_10017266 3300031903 Bacteria 3616
90 Ga0307412_10003436 3300031911 Bacteria 8803
91 Ga0307415_100007972 3300032126 Bacteria 5837
92 Ga0373949_0000025 3300035090 Bacteria 53582
93 Ga0373936_0000025 3300035113 Bacteria 127104
94 Ga0373941_0020560 3300035115 Bacteria 1852
95 Ga0373961_0000074 3300035241 Bacteria 54115
96 Ga0316582_0079922 3300036647 Bacteria 2133
97 Ga0395899_0005063 3300037312 Bacteria 10253
98 Ga0395900_0047262 3300037418 Bacteria 4431
99 Ga0395898_0141949 3300037466 Bacteria 2299
100 Ga0395905_0159956 3300037471 Bacteria 2117
101 Ga0395901_0076874 3300038443 Bacteria 3483
102 Ga0453683_0170563 3300044673 Bacteria 1378
103 Ga0466963_0053595 3300044694 Bacteria 2678
104 Ga0466971_0075909 3300044719 Bacteria 1529
105 Ga0495629_0099323 3300046459 Bacteria 2031
106 Ga0495650_0029133 3300046471 Bacteria 2522
107 Ga0496112_0151784 3300048915 Bacteria 2284
108 Ga0496117_0000278 3300048920 Bacteria 95496
109 Ga0501034_0027321 3300049571 Bacteria 5805
110 Ga0501034_0128629 3300049571 Bacteria 2517
111 Ga0501034_0189404 3300049571 Bacteria 2020
112 Ga0501034_0208343 3300049571 Bacteria 1911
113 Ga0501040_0075909 3300049576 Bacteria 2323
114 Ga0501046_0047690 3300049580 Bacteria 3396
115 Ga0501047_0033340 3300049581 Bacteria 4970
116 Ga0501070_0025360 3300049586 Bacteria 4973
117 Ga0501071_0092303 3300049587 Bacteria 2225
118 Ga0501072_0282104 3300049588 Bacteria 1321
119 Ga0501074_0028548 3300049590 Bacteria 4044
120 Ga0501076_0185753 3300049592 Bacteria 1695
121 Ga0501077_0005542 3300049593 Bacteria 7681
122 Ga0501077_0068483 3300049593 Bacteria 2250
123 Ga0501227_001125 3300049665 Bacteria 5964
124 Ga0501079_0028067 3300049741 Bacteria 4318
125 Ga0501079_0028187 3300049741 Bacteria 4308
126 Ga0501079_0071576 3300049741 Bacteria 2679
127 Ga0501079_0150028 3300049741 Bacteria 1817
128 Ga0501080_0066241 3300049742 Bacteria 3359
129 Ga0501080_0257292 3300049742 Bacteria 1591
130 Ga0501081_0028546 3300049743 Bacteria 3766
131 Ga0501035_0144735 3300049822 Bacteria 2064
132 Ga0501044_0017589 3300049823 Bacteria 7667
133 Ga0501044_0058699 3300049823 Bacteria 3945
134 Ga0501044_0184985 3300049823 Bacteria 2049
135 Ga0501045_0031620 3300049824 Bacteria 3833
136 Ga0501045_0052351 3300049824 Bacteria 2980
137 Ga0501045_0106971 3300049824 Bacteria 2073
138 nmdc:mga09592_130833_c1 3300050508 Bacteria 2159
139 nmdc:mga09592_35130_c1 3300050508 Bacteria 4194
140 nmdc:mga09592_35394_c1 3300050508 Bacteria 4180
141 nmdc:mga06r32_62992_c1 3300050510 Bacteria 3573
142 nmdc:mga0n895_322424_c1 3300050512 Bacteria 1566
143 nmdc:mga0a205_298766_c1 3300050515 Bacteria 1483
144 Ga0500635_0007657 3300053080 Bacteria 2936
145 Ga0500644_0008161 3300053088 Bacteria 2756
146 Ga0500647_0042716 3300053091 Bacteria 2177
147 Ga0500566_0009001 3300053094 Bacteria 5907
148 Ga0500566_0027562 3300053094 Bacteria 3325
149 Ga0500640_001301 3300053095 Bacteria 7437
150 Ga0500554_001040 3300053102 Bacteria 5379
151 Ga0500554_015147 3300053102 Bacteria 2007
152 Ga0500572_004718 3300053111 Bacteria 3090
153 Ga0500595_000275 3300053119 Bacteria 34021
154 Ga0500597_005442 3300053120 Bacteria 4106
155 Ga0500614_000905 3300053123 Bacteria 7475
156 Ga0500559_0004931 3300053136 Bacteria 6213
157 Ga0500568_0030740 3300053139 Bacteria 2222
158 Ga0500622_0074497 3300053156 Bacteria 1710
159 Ga0500638_067078 3300053162 Bacteria 1719
160 Ga0500645_006727 3300053730 Bacteria 4074
161 Ga0500601_001012 3300053737 Bacteria 3246
162 Ga0501084_0004728 3300054114 Bacteria 11126
163 Ga0501084_0141406 3300054114 Bacteria 2027
164 Ga0501082_0034160 3300060353 Bacteria 4387
165 Ga0501082_0071457 3300060353 Bacteria 2989
166 Ga0307515_10177905
167 Ga0070683_100062245
168 Ga0070670_100037250
169 Ga0068869_100035874
170 Ga0068869_100047851
171 Ga0070689_100052508
172 Ga0070675_100047823
173 Ga0070675_100083742
174 Ga0070674_100080988
175 Ga0070673_100019799
176 Ga0070688_100072941
177 Ga0070703_10008096
178 Ga0070701_10013243
179 Ga0070705_100157639
180 Ga0070678_100046291
181 Ga0070678_100115497
182 Ga0070706_100003300
183 Ga0070706_100078960
184 Ga0070706_100132839
185 Ga0070707_100003559
186 Ga0070707_100074795
187 Ga0070698_100001430
188 Ga0070698_100081847
189 Ga0070698_100183158
190 Ga0070686_100115504
191 Ga0070695_100041219
192 Ga0070696_100022188
193 Ga0068859_100015390
194 Ga0068861_100002550
195 Ga0068863_100114228
196 Ga0068862_100050440
197 Ga0081455_10119888
198 Ga0070717_10017222
199 Ga0068871_100050510
200 Ga0075428_100005342
201 Ga0075431_100156310
202 Ga0075433_10008313
203 Ga0075434_100041686
204 Ga0075429_100024943
205 Ga0075429_100067705
206 Ga0097620_100015390
207 Ga0075435_100031357
208 Ga0105245_10000032
209 Ga0114129_10302788
210 Ga0105248_10097710
211 Ga0105249_10110698
212 Ga0157374_10013959
213 Ga0157378_10074055
214 Ga0163163_10055134
215 Ga0207653_10006504
216 Ga0207684_10041827
217 Ga0207652_10040409
218 Ga0207646_10020013
219 Ga0207646_10068811
220 Ga0207650_10048961
221 Ga0207659_10017056
222 Ga0207659_10038670
223 Ga0207687_10000066
224 Ga0207669_10069404
225 Ga0207691_10119278
226 Ga0207689_10031896
227 Ga0207689_10040628
228 Ga0207661_10083600
229 Ga0207678_10020991
230 Ga0207702_10121875
231 Ga0207702_10201519
232 Ga0207641_10027088
233 Ga0207641_10262459
234 Ga0207675_100002786
235 Ga0207683_10037792
236 Ga0207683_10043588
237 Ga0268266_10004475
238 Ga0268266_10028376
239 Ga0268265_10087255
240 Ga0307517_10050560
241 Ga0307515_10000701
242 Ga0265332_10013193
243 Ga0307513_10004906
244 Ga0307509_10000007
245 Ga0307509_10003065
246 Ga0307509_10114604
247 Ga0307509_10136497
248 Ga0316576_10003857
249 Ga0316576_10009641
250 Ga0316578_10005309
251 Ga0316578_10008752
252 Ga0307516_10041444
253 Ga0307406_10040220
254 Ga0307407_10017266
255 Ga0307412_10003436
256 Ga0307415_100007972
257 Ga0373949_0000025
258 Ga0373936_0000025
259 Ga0373941_0020560
260 Ga0373961_0000074
261 Ga0316582_0079922
262 Ga0395899_0005063
263 Ga0395900_0047262
264 Ga0395898_0141949
265 Ga0395905_0159956
266 Ga0395901_0076874
267 Ga0453683_0170563
268 Ga0466963_0053595
269 Ga0466971_0075909
270 Ga0495629_0099323
271 Ga0495650_0029133
272 Ga0496112_0151784
273 Ga0496117_0000278
274 Ga0501034_0027321
275 Ga0501034_0128629
276 Ga0501034_0189404
277 Ga0501034_0208343
278 Ga0501040_0075909
279 Ga0501046_0047690
280 Ga0501047_0033340
281 Ga0501070_0025360
282 Ga0501071_0092303
283 Ga0501072_0282104
284 Ga0501074_0028548
285 Ga0501076_0185753
286 Ga0501077_0005542
287 Ga0501077_0068483
288 Ga0501227_001125
289 Ga0501079_0028067
290 Ga0501079_0028187
291 Ga0501079_0071576
292 Ga0501079_0150028
293 Ga0501080_0066241
294 Ga0501080_0257292
295 Ga0501081_0028546
296 Ga0501035_0144735
297 Ga0501044_0017589
298 Ga0501044_0058699
299 Ga0501044_0184985
300 Ga0501045_0031620
301 Ga0501045_0052351
302 Ga0501045_0106971
303 nmdc:mga09592_130833_c1
304 nmdc:mga09592_35130_c1
305 nmdc:mga09592_35394_c1
306 nmdc:mga06r32_62992_c1
307 nmdc:mga0n895_322424_c1
308 nmdc:mga0a205_298766_c1
309 Ga0500635_0007657
310 Ga0500644_0008161
311 Ga0500647_0042716
312 Ga0500566_0009001
313 Ga0500566_0027562
314 Ga0500640_001301
315 Ga0500554_001040
316 Ga0500554_015147
317 Ga0500572_004718
318 Ga0500595_000275
319 Ga0500597_005442
320 Ga0500614_000905
321 Ga0500559_0004931
322 Ga0500568_0030740
323 Ga0500622_0074497
324 Ga0500638_067078
325 Ga0500645_006727
326 Ga0500601_001012
327 Ga0501084_0004728
328 Ga0501084_0141406
329 Ga0501082_0034160
330 Ga0501082_0071457

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02878

PGM_PMM_I

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I

40

176

0.97

PF02880

PGM_PMM_III

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III

299

412

0.97

PF02879

PGM_PMM_II

Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II

198

295

0.84

PF00408

PGM_PMM_IV

Phosphoglucomutase/phosphomannomutase, C-terminal domain

400

483

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9731 11 379
7olh-assembly3.cif.gz_E bacillus subtilis complex structure 1 of diadenylate cyclase cdaa cytoplasmic domain (cdaacd) and the phosphoglucomutase glmm short variant (glmmf369) 0.9679 11 379
6gyz-assembly1.cif.gz_B crystal structure of glmm from staphylococcus aureus 0.9611 11 458
6gyz-assembly1.cif.gz_B crystal structure of glmm from staphylococcus aureus 0.9569 11 458
3i3w-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.938 11 455
ID Description Score Start End Superfamily
6gyzB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9849 165 265 3.40.120.10
6gyzB03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9796 266 349 3.40.120.10
6gyzB03 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9683 266 349 3.40.120.10
af_P31120_3_154_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9645 10 162 3.40.120.10
af_P9WN41_1_139_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.9621 12 142 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A4Q6FLR7-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.984 11 279 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A3S1DCX5-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.9837 92 359 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A5A8F624-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.9809 10 457 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A2N3D1H0-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.9806 9 449 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252
AF-A0A0F6W4Y3-F1-model_v4 Phosphoglucosamine mutase (EC 5.4.2.10) 0.979 6 457 GO:0000287
GO:0004615
GO:0005829
GO:0005975
GO:0006048
GO:0008966
GO:0009252

Map