F246091

General Info

Members Datasets Scaffolds Average Seq Length
165 120 162 429

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000329|Ga0105238_1000032918
Length 501
Sequence MDAWKSPQAKHVRMRLIHIQQTDFEVRTNFIIPNKLVGLNYCWLDARRLADDSEQRRSIIESCPTQVRLPMIQFRLMIASIVTVLTVCGGLMAQEFKVGTARRIITPDPLLPVSGGLGPTSPVREKQGELMARVVVYQKGDTTVAMVSLDLLGFPAVLCERVRSQVPRLVPRNILIGSTHTHSAPDCYALPDGRGGLTGDLTYIDTVVIKAAEAINAAIDDVRPARIKIATGEAKGKIAYNYYAPDLYDRRMSIIQAVDAADKPLATLVNYAIHPEVLGSGAGILSPDLIGPMCDRIESQVGGHALFLNGAQGGMITADNRDLNRPKDPVRAVWHDDRTWSECVRIGNTMADEALRLIQDVPVQKSPTLFCDSIDVKFPVDSDLLWNAVLASPLKYPRNADRTVTSQINILNLGNAQILTIPGEALPNIGFYLKRKMHGEHNMLFGLTNDAFGYILTKVDFHSFPRYEYISRTSLGEMTGEILIDRSVEFIDRSPRPDTIP

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
3 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
84 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
85 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
108 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
109 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
116 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 0
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 0
Rhizosphere 96.97
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1009905 3300003781 Bacteria 3868
2 Ga0065165_1000226 3300005262 Bacteria 99005
3 Ga0065707_10085165 3300005295 Bacteria 6392
4 Ga0070676_10009514 3300005328 Bacteria 5248
5 Ga0068869_100186775 3300005334 Bacteria 1628
6 Ga0068869_100208118 3300005334 Bacteria 1545
7 Ga0070680_100161109 3300005336 Bacteria 1885
8 Ga0068868_100009027 3300005338 Bacteria 7155
9 Ga0070660_100004409 3300005339 Bacteria 9724
10 Ga0070669_100015071 3300005353 Bacteria 5509
11 Ga0070675_100025402 3300005354 Bacteria 4749
12 Ga0070673_100050713 3300005364 Bacteria 3246
13 Ga0070688_100126142 3300005365 Bacteria 1720
14 Ga0070659_100008396 3300005366 Bacteria 7543
15 Ga0070713_100034907 3300005436 Unclassified 4046
16 Ga0070700_100043495 3300005441 Bacteria 2763
17 Ga0070694_100002828 3300005444 Bacteria 10307
18 Ga0070678_100072387 3300005456 Bacteria 2583
19 Ga0070681_10114344 3300005458 Bacteria 2637
20 Ga0070679_100004621 3300005530 Bacteria 12709
21 Ga0068853_100002231 3300005539 Bacteria 14490
22 Ga0068853_100052678 3300005539 Unclassified 3505
23 Ga0070672_100072024 3300005543 Bacteria 2751
24 Ga0070686_100060150 3300005544 Bacteria 2450
25 Ga0070665_100000302 3300005548 Bacteria 76955
26 Ga0070665_100152118 3300005548 Bacteria 2316
27 Ga0068855_100005361 3300005563 Bacteria 15642
28 Ga0068855_100009370 3300005563 Bacteria 11824
29 Ga0068855_100058750 3300005563 Bacteria 4502
30 Ga0068855_100147553 3300005563 Unclassified 2676
31 Ga0068857_100007425 3300005577 Bacteria 9434
32 Ga0068857_100010498 3300005577 Bacteria 8049
33 Ga0068854_100091864 3300005578 Unclassified 2260
34 Ga0068852_100023064 3300005616 Bacteria 5003
35 Ga0068859_100047133 3300005617 Unclassified 4330
36 Ga0068859_100058709 3300005617 Bacteria 3875
37 Ga0068859_100071774 3300005617 Bacteria 3498
38 Ga0068859_100186809 3300005617 Bacteria 2156
39 Ga0068870_10038159 3300005840 Bacteria 2479
40 Ga0068863_100029206 3300005841 Bacteria 5264
41 Ga0068863_100297245 3300005841 Bacteria 1566
42 Ga0068860_100048990 3300005843 Bacteria 4026
43 Ga0075368_10035741 3300006042 Bacteria 1940
44 Ga0097621_100037809 3300006237 Bacteria 3871
45 Ga0075428_100011229 3300006844 Bacteria 9967
46 Ga0075428_100053057 3300006844 Bacteria 4442
47 Ga0075429_100050405 3300006880 Bacteria 3622
48 Ga0097620_100047133 3300006931 Unclassified 4330
49 Ga0097620_100058706 3300006931 Bacteria 3875
50 Ga0097620_100071774 3300006931 Bacteria 3498
51 Ga0097620_100186808 3300006931 Bacteria 2156
52 Ga0075435_100077947 3300007076 Bacteria 2717
53 Ga0105240_10014835 3300009093 Bacteria 10621
54 Ga0111539_10032535 3300009094 Bacteria 6332
55 Ga0111539_10204263 3300009094 Bacteria 2303
56 Ga0111539_10207663 3300009094 Unclassified 2282
57 Ga0105245_10022758 3300009098 Bacteria 5500
58 Ga0105245_10201046 3300009098 Bacteria 1913
59 Ga0105238_10000329 3300009551 Bacteria 51763
60 Ga0105238_10004631 3300009551 Bacteria 13617
61 Ga0105246_10075948 3300011119 Bacteria 2380
62 Ga0157371_10021941 3300013102 Bacteria 4687
63 Ga0157371_10025236 3300013102 Bacteria 4334
64 Ga0157370_10054734 3300013104 Bacteria 3803
65 Ga0157370_10177894 3300013104 Bacteria 1977
66 Ga0157369_10030955 3300013105 Bacteria 5897
67 Ga0157369_10136239 3300013105 Bacteria 2599
68 Ga0157374_10103457 3300013296 Unclassified 2732
69 Ga0157372_10002881 3300013307 Bacteria 18600
70 Ga0157372_10056685 3300013307 Unclassified 4377
71 Ga0157375_10000033 3300013308 Bacteria 184526
72 Ga0163163_10000167 3300014325 Bacteria 68931
73 Ga0209676_1001032 3300025292 Bacteria 32333
74 Ga0207688_10030663 3300025901 Bacteria 2966
75 Ga0207705_10037277 3300025909 Unclassified 3479
76 Ga0207707_10134728 3300025912 Bacteria 2160
77 Ga0207695_10006159 3300025913 Bacteria 15639
78 Ga0207695_10024977 3300025913 Bacteria 6704
79 Ga0207657_10008882 3300025919 Bacteria 10165
80 Ga0207657_10010419 3300025919 Bacteria 9280
81 Ga0207657_10093705 3300025919 Bacteria 2501
82 Ga0207652_10066084 3300025921 Unclassified 3133
83 Ga0207652_10091750 3300025921 Bacteria 2671
84 Ga0207694_10002407 3300025924 Bacteria 15294
85 Ga0207670_10001166 3300025936 Bacteria 13854
86 Ga0207704_10044078 3300025938 Bacteria 2640
87 Ga0207704_10052494 3300025938 Bacteria 2472
88 Ga0207691_10008587 3300025940 Bacteria 9804
89 Ga0207689_10002113 3300025942 Bacteria 18676
90 Ga0207667_10001238 3300025949 Bacteria 32040
91 Ga0207667_10003561 3300025949 Bacteria 19247
92 Ga0207667_10054054 3300025949 Bacteria 4224
93 Ga0207651_10019583 3300025960 Bacteria 4060
94 Ga0207640_10073493 3300025981 Unclassified 2311
95 Ga0207658_10206065 3300025986 Bacteria 1645
96 Ga0207677_10018393 3300026023 Bacteria 4192
97 Ga0207639_10093936 3300026041 Bacteria 2406
98 Ga0207648_10002625 3300026089 Bacteria 19241
99 Ga0207674_10013755 3300026116 Bacteria 8957
100 Ga0207675_100169288 3300026118 Bacteria 2088
101 Ga0207683_10039322 3300026121 Bacteria 4126
102 Ga0207698_10013228 3300026142 Bacteria 5436
103 Ga0268266_10000410 3300028379 Bacteria 65248
104 Ga0268266_10042558 3300028379 Bacteria 3880
105 Ga0265338_10014870 3300028800 Bacteria 8608
106 Ga0265338_10028845 3300028800 Bacteria 5522
107 Ga0265338_10044647 3300028800 Bacteria 4088
108 Ga0265332_10012452 3300031238 Bacteria 3775
109 Ga0265329_10001442 3300031242 Bacteria 11458
110 Ga0265339_10006685 3300031249 Bacteria 7537
111 Ga0265331_10005550 3300031250 Bacteria 7599
112 Ga0265316_10064367 3300031344 Bacteria 2841
113 Ga0265313_10007266 3300031595 Bacteria 7605
114 Ga0265314_10000804 3300031711 Bacteria 37298
115 Ga0265314_10010952 3300031711 Bacteria 7527
116 Ga0265342_10011891 3300031712 Bacteria 5922
117 Ga0307405_10007633 3300031731 Bacteria 5428
118 Ga0307412_10074068 3300031911 Unclassified 2332
119 Ga0307412_10108774 3300031911 Bacteria 1975
120 Ga0307409_100080949 3300031995 Unclassified 2623
121 Ga0307416_100132163 3300032002 Unclassified 2249
122 Ga0307414_10062179 3300032004 Bacteria 2648
123 Ga0373935_0047563 3300035692 Bacteria 2713
124 Ga0373927_0017040 3300035695 Bacteria 4787
125 Ga0373947_0004551 3300035725 Bacteria 8129
126 Ga0373925_0003465 3300037068 Bacteria 12199
127 Ga0451577_0002947 3300042876 Bacteria 19496
128 Ga0453683_0000246 3300044673 Bacteria 72041
129 Ga0453684_0008480 3300044712 Bacteria 18384
130 Ga0453684_0017653 3300044712 Bacteria 11031
131 Ga0453684_0056372 3300044712 Archaea 5098
132 Ga0453684_0332188 3300044712 Bacteria 1719
133 Ga0451576_0000090 3300045051 Bacteria 231703
134 Ga0451576_0194737 3300045051 Bacteria 2117
135 Ga0495582_0007004 3300046473 Bacteria 6270
136 Ga0495630_0000077 3300046517 Bacteria 76692
137 Ga0495666_0006916 3300046526 Bacteria 5697
138 Ga0495640_0022741 3300046533 Bacteria 4578
139 Ga0495586_0000044 3300046535 Bacteria 74379
140 Ga0495645_0040110 3300046543 Unclassified 3415
141 Ga0495634_0015469 3300046642 Bacteria 5483
142 Ga0495658_0019112 3300046683 Bacteria 3572
143 Ga0495674_0000586 3300047319 Bacteria 34088
144 Ga0495672_0066637 3300047320 Bacteria 2054
145 Ga0495676_0026204 3300047321 Bacteria 5021
146 Ga0501034_0004779 3300049571 Bacteria 14988
147 Ga0501034_0010765 3300049571 Bacteria 9500
148 Ga0501034_0011027 3300049571 Bacteria 9383
149 Ga0501036_0205662 3300049572 Unclassified 1655
150 Ga0501036_0215581 3300049572 Unclassified 1613
151 Ga0501043_0117018 3300049579 Bacteria 2091
152 Ga0501046_0007480 3300049580 Bacteria 9591
153 Ga0501046_0015576 3300049580 Bacteria 6386
154 Ga0501047_0018686 3300049581 Bacteria 6646
155 Ga0501047_0042967 3300049581 Unclassified 4367
156 Ga0501070_0000890 3300049586 Bacteria 27159
157 Ga0501217_001207 3300049661 Bacteria 4767
158 Ga0501044_0072463 3300049823 Bacteria 3502
159 nmdc:mga09592_44610_c1 3300050508 Bacteria 3733
160 nmdc:mga08y16_190329_c1 3300050511 Unclassified 2128
161 nmdc:mga08y16_26352_c1 3300050511 Bacteria 6129
162 nmdc:mga0rr50_68578_c1 3300050513 Bacteria 2697

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035692 Ga0373935_0047563 Ga0373935_0047563_150_1235 361
2 3300009093 Ga0105240_10014835 Ga0105240_100148352 400
3 3300025913 Ga0207695_10006159 Ga0207695_1000615914 400
4 3300042876 Ga0451577_0002947 Ga0451577_0002947_10707_11918 403
5 3300032002 Ga0307416_100132163 Ga0307416_1001321632 404
6 3300005530 Ga0070679_100004621 Ga0070679_1000046215 407
7 3300005539 Ga0068853_100052678 Ga0068853_1000526783 407
8 3300005563 Ga0068855_100147553 Ga0068855_1001475532 407
9 3300005616 Ga0068852_100023064 Ga0068852_1000230642 407
10 3300013102 Ga0157371_10021941 Ga0157371_100219412 407
11 3300013104 Ga0157370_10054734 Ga0157370_100547342 407
12 3300025909 Ga0207705_10037277 Ga0207705_100372773 407
13 3300025919 Ga0207657_10008882 Ga0207657_100088825 407
14 3300025921 Ga0207652_10066084 Ga0207652_100660842 407
15 3300005841 Ga0068863_100297245 Ga0068863_1002972452 408
16 3300005617 Ga0068859_100047133 Ga0068859_1000471332 411
17 3300006931 Ga0097620_100047133 Ga0097620_1000471332 411
18 iso_pu_bacteria 2687453257 2688068675 413
19 3300009094 Ga0111539_10207663 Ga0111539_102076632 414
20 3300050511 nmdc:mga08y16_190329_c1 nmdc:mga08y16_190329_c1_603_1853 414
21 3300035695 Ga0373927_0017040 Ga0373927_0017040_813_2060 415
22 3300035725 Ga0373947_0004551 Ga0373947_0004551_3832_5079 415
23 3300037068 Ga0373925_0003465 Ga0373925_0003465_4648_5895 415
24 3300049661 Ga0501217_001207 Ga0501217_001207_1081_2349 415
25 3300006844 Ga0075428_100011229 Ga0075428_1000112296 416
26 3300006844 Ga0075428_100053057 Ga0075428_1000530573 416
27 3300006880 Ga0075429_100050405 Ga0075429_1000504051 416
28 3300009094 Ga0111539_10032535 Ga0111539_100325353 416
29 3300009094 Ga0111539_10204263 Ga0111539_102042631 416
30 3300013296 Ga0157374_10103457 Ga0157374_101034573 416
31 3300031242 Ga0265329_10001442 Ga0265329_100014425 416
32 3300031344 Ga0265316_10064367 Ga0265316_100643672 416
33 3300031711 Ga0265314_10000804 Ga0265314_1000080426 416
34 3300049579 Ga0501043_0117018 Ga0501043_0117018_377_1675 416
35 3300049580 Ga0501046_0015576 Ga0501046_0015576_4386_5684 416
36 3300049581 Ga0501047_0042967 Ga0501047_0042967_1736_3034 416
37 3300049586 Ga0501070_0000890 Ga0501070_0000890_11206_12504 416
38 3300050508 nmdc:mga09592_44610_c1 nmdc:mga09592_44610_c1_345_1595 416
39 3300050511 nmdc:mga08y16_26352_c1 nmdc:mga08y16_26352_c1_3596_4909 416
40 3300005436 Ga0070713_100034907 Ga0070713_1000349074 417
41 3300005444 Ga0070694_100002828 Ga0070694_1000028285 417
42 3300005544 Ga0070686_100060150 Ga0070686_1000601501 417
43 3300005563 Ga0068855_100009370 Ga0068855_1000093702 417
44 3300005578 Ga0068854_100091864 Ga0068854_1000918642 417
45 3300014325 Ga0163163_10000167 Ga0163163_1000016755 417
46 3300025949 Ga0207667_10054054 Ga0207667_100540543 417
47 3300025981 Ga0207640_10073493 Ga0207640_100734932 417
48 3300028800 Ga0265338_10014870 Ga0265338_100148702 417
49 3300005295 Ga0065707_10085165 Ga0065707_100851656 418
50 3300005441 Ga0070700_100043495 Ga0070700_1000434952 418
51 3300005563 Ga0068855_100005361 Ga0068855_10000536112 418
52 3300005577 Ga0068857_100010498 Ga0068857_1000104987 418
53 3300013308 Ga0157375_10000033 Ga0157375_1000003351 418
54 3300025949 Ga0207667_10003561 Ga0207667_100035615 418
55 3300046543 Ga0495645_0040110 Ga0495645_0040110_377_1636 418
56 iso_pu_bacteria 2920107658 2920109054 418
57 3300005617 Ga0068859_100186809 Ga0068859_1001868091 419
58 3300006931 Ga0097620_100186808 Ga0097620_1001868081 419
59 3300009098 Ga0105245_10022758 Ga0105245_100227586 419
60 3300009551 Ga0105238_10000329 Ga0105238_1000032918 419
61 3300013307 Ga0157372_10056685 Ga0157372_100566852 419
62 3300025924 Ga0207694_10002407 Ga0207694_100024075 419
63 3300028800 Ga0265338_10028845 Ga0265338_100288453 419
64 3300031238 Ga0265332_10012452 Ga0265332_100124523 419
65 3300031249 Ga0265339_10006685 Ga0265339_100066853 419
66 3300031250 Ga0265331_10005550 Ga0265331_100055503 419
67 3300031595 Ga0265313_10007266 Ga0265313_100072663 419
68 3300031711 Ga0265314_10010952 Ga0265314_100109526 419
69 3300031712 Ga0265342_10011891 Ga0265342_100118913 419
70 3300044712 Ga0453684_0008480 Ga0453684_0008480_10798_12066 419
71 3300044712 Ga0453684_0017653 Ga0453684_0017653_2669_3946 419
72 3300044712 Ga0453684_0332188 Ga0453684_0332188_393_1700 419
73 3300045051 Ga0451576_0194737 Ga0451576_0194737_690_1949 419
74 3300046473 Ga0495582_0007004 Ga0495582_0007004_57_1328 419
75 3300046517 Ga0495630_0000077 Ga0495630_0000077_24671_25942 419
76 3300046526 Ga0495666_0006916 Ga0495666_0006916_4416_5687 419
77 3300046533 Ga0495640_0022741 Ga0495640_0022741_2913_4184 419
78 3300046535 Ga0495586_0000044 Ga0495586_0000044_22311_23582 419
79 3300046642 Ga0495634_0015469 Ga0495634_0015469_1577_2848 419
80 3300046683 Ga0495658_0019112 Ga0495658_0019112_417_1688 419
81 3300047319 Ga0495674_0000586 Ga0495674_0000586_20430_21701 419
82 3300047321 Ga0495676_0026204 Ga0495676_0026204_1727_2998 419
83 3300005365 Ga0070688_100126142 Ga0070688_1001261421 420
84 3300005539 Ga0068853_100002231 Ga0068853_1000022316 420
85 3300005548 Ga0070665_100000302 Ga0070665_10000030215 420
86 3300005617 Ga0068859_100071774 Ga0068859_1000717745 420
87 3300005841 Ga0068863_100029206 Ga0068863_1000292067 420
88 3300006042 Ga0075368_10035741 Ga0075368_100357412 420
89 3300006931 Ga0097620_100071774 Ga0097620_1000717741 420
90 3300025936 Ga0207670_10001166 Ga0207670_1000116612 420
91 3300028379 Ga0268266_10000410 Ga0268266_1000041046 420
92 3300028800 Ga0265338_10044647 Ga0265338_100446472 420
93 3300049571 Ga0501034_0004779 Ga0501034_0004779_11881_13176 420
94 3300049572 Ga0501036_0205662 Ga0501036_0205662_250_1545 420
95 3300049580 Ga0501046_0007480 Ga0501046_0007480_3152_4447 420
96 3300049581 Ga0501047_0018686 Ga0501047_0018686_1685_2980 420
97 3300005336 Ga0070680_100161109 Ga0070680_1001611092 421
98 3300005366 Ga0070659_100008396 Ga0070659_1000083964 421
99 3300005458 Ga0070681_10114344 Ga0070681_101143442 421
100 3300013105 Ga0157369_10030955 Ga0157369_100309552 421
101 3300025912 Ga0207707_10134728 Ga0207707_101347281 421
102 3300025919 Ga0207657_10010419 Ga0207657_100104192 421
103 3300025921 Ga0207652_10091750 Ga0207652_100917503 421
104 3300026041 Ga0207639_10093936 Ga0207639_100939362 421
105 iso_pu_bacteria 2522125168 2522547698 421
106 3300005334 Ga0068869_100186775 Ga0068869_1001867751 422
107 3300005334 Ga0068869_100208118 Ga0068869_1002081181 422
108 3300007076 Ga0075435_100077947 Ga0075435_1000779472 422
109 3300025938 Ga0207704_10052494 Ga0207704_100524942 422
110 3300044673 Ga0453683_0000246 Ga0453683_0000246_64036_65307 422
111 3300044712 Ga0453684_0056372 Ga0453684_0056372_2469_3740 422
112 3300045051 Ga0451576_0000090 Ga0451576_0000090_166405_167676 422
113 3300050513 nmdc:mga0rr50_68578_c1 nmdc:mga0rr50_68578_c1_759_2030 422
114 3300005563 Ga0068855_100058750 Ga0068855_1000587502 423
115 3300005577 Ga0068857_100007425 Ga0068857_1000074253 423
116 3300009551 Ga0105238_10004631 Ga0105238_100046315 423
117 3300013102 Ga0157371_10025236 Ga0157371_100252362 423
118 3300013104 Ga0157370_10177894 Ga0157370_101778941 423
119 3300013105 Ga0157369_10136239 Ga0157369_101362392 423
120 3300013307 Ga0157372_10002881 Ga0157372_1000288110 423
121 3300025913 Ga0207695_10024977 Ga0207695_100249774 423
122 3300025949 Ga0207667_10001238 Ga0207667_1000123812 423
123 3300026116 Ga0207674_10013755 Ga0207674_100137553 423
124 3300026142 Ga0207698_10013228 Ga0207698_100132283 423
125 3300031911 Ga0307412_10074068 Ga0307412_100740682 423
126 3300031995 Ga0307409_100080949 Ga0307409_1000809492 423
127 3300049571 Ga0501034_0010765 Ga0501034_0010765_4523_5872 423
128 3300049571 Ga0501034_0011027 Ga0501034_0011027_6834_8111 423
129 3300049572 Ga0501036_0215581 Ga0501036_0215581_98_1375 423
130 3300049823 Ga0501044_0072463 Ga0501044_0072463_1830_3107 423
131 3300005328 Ga0070676_10009514 Ga0070676_100095143 424
132 3300005338 Ga0068868_100009027 Ga0068868_1000090273 424
133 3300005353 Ga0070669_100015071 Ga0070669_1000150712 424
134 3300005354 Ga0070675_100025402 Ga0070675_1000254022 424
135 3300005364 Ga0070673_100050713 Ga0070673_1000507132 424
136 3300005456 Ga0070678_100072387 Ga0070678_1000723872 424
137 3300005543 Ga0070672_100072024 Ga0070672_1000720242 424
138 3300005548 Ga0070665_100152118 Ga0070665_1001521182 424
139 3300005617 Ga0068859_100058709 Ga0068859_1000587092 424
140 3300005840 Ga0068870_10038159 Ga0068870_100381592 424
141 3300006237 Ga0097621_100037809 Ga0097621_1000378093 424
142 3300006931 Ga0097620_100058706 Ga0097620_1000587062 424
143 3300009098 Ga0105245_10201046 Ga0105245_102010462 424
144 3300011119 Ga0105246_10075948 Ga0105246_100759482 424
145 3300025901 Ga0207688_10030663 Ga0207688_100306632 424
146 3300025938 Ga0207704_10044078 Ga0207704_100440782 424
147 3300025940 Ga0207691_10008587 Ga0207691_100085872 424
148 3300025942 Ga0207689_10002113 Ga0207689_1000211317 424
149 3300025960 Ga0207651_10019583 Ga0207651_100195833 424
150 3300025986 Ga0207658_10206065 Ga0207658_102060652 424
151 3300026023 Ga0207677_10018393 Ga0207677_100183932 424
152 3300026089 Ga0207648_10002625 Ga0207648_100026256 424
153 3300026118 Ga0207675_100169288 Ga0207675_1001692882 424
154 3300026121 Ga0207683_10039322 Ga0207683_100393222 424
155 3300028379 Ga0268266_10042558 Ga0268266_100425583 424
156 3300047320 Ga0495672_0066637 Ga0495672_0066637_461_1735 424
157 3300003781 Ga0055536_1009905 Ga0055536_10099052 425
158 3300005262 Ga0065165_1000226 Ga0065165_100022622 425
159 3300005339 Ga0070660_100004409 Ga0070660_1000044097 425
160 3300005843 Ga0068860_100048990 Ga0068860_1000489902 425
161 3300025292 Ga0209676_1001032 Ga0209676_100103222 425
162 3300025919 Ga0207657_10093705 Ga0207657_100937051 425
163 3300031731 Ga0307405_10007633 Ga0307405_100076332 425
164 3300031911 Ga0307412_10108774 Ga0307412_101087742 425
165 3300032004 Ga0307414_10062179 Ga0307414_100621792 425

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgk-assembly1.cif.gz_A crystal structure of human neutral ceramidase with zn-bound phosphate 0.7777 23 415
2zws-assembly1.cif.gz_A crystal structure analysis of neutral ceramidase from pseudomonas aeruginosa 0.7766 21 424
4wgk-assembly2.cif.gz_B crystal structure of human neutral ceramidase with zn-bound phosphate 0.7718 22 415
2zxc-assembly2.cif.gz_B ceramidase complexed with c2 0.7601 21 424
2zws-assembly1.cif.gz_A crystal structure analysis of neutral ceramidase from pseudomonas aeruginosa 0.7412 21 424
ID Description Score Start End Superfamily
4ws9B02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;S-adenosylmethionine synthetase, N-terminal domain 0.7926 60 77 3.30.300.340
af_A0A1D8PFG6_11_164_3.30.230.90 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.6265 26 77 3.30.230.90
3imlB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.6254 175 202 3.30.300.10
1jpdX01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.6232 21 77 3.30.390.10
af_Q60269_1_415_3.30.2170.10 Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily 0.6145 21 77 3.30.2170.10
ID Description Score Start End GO Terms
AF-A0A316E2G9-F1-model_v4 Neutral/alkaline ceramidase-like enzyme 0.9879 21 424 GO:0016020
AF-A0A6G3ZCQ9-F1-model_v4 Neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein 0.9864 21 355
AF-A0A3C0UY26-F1-model_v4 Neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein 0.9828 21 315
AF-A0A3C1UR21-F1-model_v4 Neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein 0.9821 22 289
AF-X1M8R6-F1-model_v4 DUF362 domain-containing protein 0.9819 149 414

Feature Viewer

pLDDT pTM Quality
92.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map