F246091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 165 | 120 | 162 | 429 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10000329|Ga0105238_1000032918 |
| Length | 501 |
| Sequence | MDAWKSPQAKHVRMRLIHIQQTDFEVRTNFIIPNKLVGLNYCWLDARRLADDSEQRRSIIESCPTQVRLPMIQFRLMIASIVTVLTVCGGLMAQEFKVGTARRIITPDPLLPVSGGLGPTSPVREKQGELMARVVVYQKGDTTVAMVSLDLLGFPAVLCERVRSQVPRLVPRNILIGSTHTHSAPDCYALPDGRGGLTGDLTYIDTVVIKAAEAINAAIDDVRPARIKIATGEAKGKIAYNYYAPDLYDRRMSIIQAVDAADKPLATLVNYAIHPEVLGSGAGILSPDLIGPMCDRIESQVGGHALFLNGAQGGMITADNRDLNRPKDPVRAVWHDDRTWSECVRIGNTMADEALRLIQDVPVQKSPTLFCDSIDVKFPVDSDLLWNAVLASPLKYPRNADRTVTSQINILNLGNAQILTIPGEALPNIGFYLKRKMHGEHNMLFGLTNDAFGYILTKVDFHSFPRYEYISRTSLGEMTGEILIDRSVEFIDRSPRPDTIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2687453257 | Planctomyces sp. SH-PL62 | Isolate | Unclassified |
| 3 | 2920107658 | Aquisphaera insulae JC669 | Isolate | Rhizosphere |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 32 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 78 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 79 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 80 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 81 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 83 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 86 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 87 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 88 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 91 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 92 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 93 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 94 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 95 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 96 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 99 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 117 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 118 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.18 |
| Metatranscriptomes | 0 |
| Isolates | 1.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.42 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055536_1009905 | 3300003781 | Bacteria | 3868 |
| 2 | Ga0065165_1000226 | 3300005262 | Bacteria | 99005 |
| 3 | Ga0065707_10085165 | 3300005295 | Bacteria | 6392 |
| 4 | Ga0070676_10009514 | 3300005328 | Bacteria | 5248 |
| 5 | Ga0068869_100186775 | 3300005334 | Bacteria | 1628 |
| 6 | Ga0068869_100208118 | 3300005334 | Bacteria | 1545 |
| 7 | Ga0070680_100161109 | 3300005336 | Bacteria | 1885 |
| 8 | Ga0068868_100009027 | 3300005338 | Bacteria | 7155 |
| 9 | Ga0070660_100004409 | 3300005339 | Bacteria | 9724 |
| 10 | Ga0070669_100015071 | 3300005353 | Bacteria | 5509 |
| 11 | Ga0070675_100025402 | 3300005354 | Bacteria | 4749 |
| 12 | Ga0070673_100050713 | 3300005364 | Bacteria | 3246 |
| 13 | Ga0070688_100126142 | 3300005365 | Bacteria | 1720 |
| 14 | Ga0070659_100008396 | 3300005366 | Bacteria | 7543 |
| 15 | Ga0070713_100034907 | 3300005436 | Unclassified | 4046 |
| 16 | Ga0070700_100043495 | 3300005441 | Bacteria | 2763 |
| 17 | Ga0070694_100002828 | 3300005444 | Bacteria | 10307 |
| 18 | Ga0070678_100072387 | 3300005456 | Bacteria | 2583 |
| 19 | Ga0070681_10114344 | 3300005458 | Bacteria | 2637 |
| 20 | Ga0070679_100004621 | 3300005530 | Bacteria | 12709 |
| 21 | Ga0068853_100002231 | 3300005539 | Bacteria | 14490 |
| 22 | Ga0068853_100052678 | 3300005539 | Unclassified | 3505 |
| 23 | Ga0070672_100072024 | 3300005543 | Bacteria | 2751 |
| 24 | Ga0070686_100060150 | 3300005544 | Bacteria | 2450 |
| 25 | Ga0070665_100000302 | 3300005548 | Bacteria | 76955 |
| 26 | Ga0070665_100152118 | 3300005548 | Bacteria | 2316 |
| 27 | Ga0068855_100005361 | 3300005563 | Bacteria | 15642 |
| 28 | Ga0068855_100009370 | 3300005563 | Bacteria | 11824 |
| 29 | Ga0068855_100058750 | 3300005563 | Bacteria | 4502 |
| 30 | Ga0068855_100147553 | 3300005563 | Unclassified | 2676 |
| 31 | Ga0068857_100007425 | 3300005577 | Bacteria | 9434 |
| 32 | Ga0068857_100010498 | 3300005577 | Bacteria | 8049 |
| 33 | Ga0068854_100091864 | 3300005578 | Unclassified | 2260 |
| 34 | Ga0068852_100023064 | 3300005616 | Bacteria | 5003 |
| 35 | Ga0068859_100047133 | 3300005617 | Unclassified | 4330 |
| 36 | Ga0068859_100058709 | 3300005617 | Bacteria | 3875 |
| 37 | Ga0068859_100071774 | 3300005617 | Bacteria | 3498 |
| 38 | Ga0068859_100186809 | 3300005617 | Bacteria | 2156 |
| 39 | Ga0068870_10038159 | 3300005840 | Bacteria | 2479 |
| 40 | Ga0068863_100029206 | 3300005841 | Bacteria | 5264 |
| 41 | Ga0068863_100297245 | 3300005841 | Bacteria | 1566 |
| 42 | Ga0068860_100048990 | 3300005843 | Bacteria | 4026 |
| 43 | Ga0075368_10035741 | 3300006042 | Bacteria | 1940 |
| 44 | Ga0097621_100037809 | 3300006237 | Bacteria | 3871 |
| 45 | Ga0075428_100011229 | 3300006844 | Bacteria | 9967 |
| 46 | Ga0075428_100053057 | 3300006844 | Bacteria | 4442 |
| 47 | Ga0075429_100050405 | 3300006880 | Bacteria | 3622 |
| 48 | Ga0097620_100047133 | 3300006931 | Unclassified | 4330 |
| 49 | Ga0097620_100058706 | 3300006931 | Bacteria | 3875 |
| 50 | Ga0097620_100071774 | 3300006931 | Bacteria | 3498 |
| 51 | Ga0097620_100186808 | 3300006931 | Bacteria | 2156 |
| 52 | Ga0075435_100077947 | 3300007076 | Bacteria | 2717 |
| 53 | Ga0105240_10014835 | 3300009093 | Bacteria | 10621 |
| 54 | Ga0111539_10032535 | 3300009094 | Bacteria | 6332 |
| 55 | Ga0111539_10204263 | 3300009094 | Bacteria | 2303 |
| 56 | Ga0111539_10207663 | 3300009094 | Unclassified | 2282 |
| 57 | Ga0105245_10022758 | 3300009098 | Bacteria | 5500 |
| 58 | Ga0105245_10201046 | 3300009098 | Bacteria | 1913 |
| 59 | Ga0105238_10000329 | 3300009551 | Bacteria | 51763 |
| 60 | Ga0105238_10004631 | 3300009551 | Bacteria | 13617 |
| 61 | Ga0105246_10075948 | 3300011119 | Bacteria | 2380 |
| 62 | Ga0157371_10021941 | 3300013102 | Bacteria | 4687 |
| 63 | Ga0157371_10025236 | 3300013102 | Bacteria | 4334 |
| 64 | Ga0157370_10054734 | 3300013104 | Bacteria | 3803 |
| 65 | Ga0157370_10177894 | 3300013104 | Bacteria | 1977 |
| 66 | Ga0157369_10030955 | 3300013105 | Bacteria | 5897 |
| 67 | Ga0157369_10136239 | 3300013105 | Bacteria | 2599 |
| 68 | Ga0157374_10103457 | 3300013296 | Unclassified | 2732 |
| 69 | Ga0157372_10002881 | 3300013307 | Bacteria | 18600 |
| 70 | Ga0157372_10056685 | 3300013307 | Unclassified | 4377 |
| 71 | Ga0157375_10000033 | 3300013308 | Bacteria | 184526 |
| 72 | Ga0163163_10000167 | 3300014325 | Bacteria | 68931 |
| 73 | Ga0209676_1001032 | 3300025292 | Bacteria | 32333 |
| 74 | Ga0207688_10030663 | 3300025901 | Bacteria | 2966 |
| 75 | Ga0207705_10037277 | 3300025909 | Unclassified | 3479 |
| 76 | Ga0207707_10134728 | 3300025912 | Bacteria | 2160 |
| 77 | Ga0207695_10006159 | 3300025913 | Bacteria | 15639 |
| 78 | Ga0207695_10024977 | 3300025913 | Bacteria | 6704 |
| 79 | Ga0207657_10008882 | 3300025919 | Bacteria | 10165 |
| 80 | Ga0207657_10010419 | 3300025919 | Bacteria | 9280 |
| 81 | Ga0207657_10093705 | 3300025919 | Bacteria | 2501 |
| 82 | Ga0207652_10066084 | 3300025921 | Unclassified | 3133 |
| 83 | Ga0207652_10091750 | 3300025921 | Bacteria | 2671 |
| 84 | Ga0207694_10002407 | 3300025924 | Bacteria | 15294 |
| 85 | Ga0207670_10001166 | 3300025936 | Bacteria | 13854 |
| 86 | Ga0207704_10044078 | 3300025938 | Bacteria | 2640 |
| 87 | Ga0207704_10052494 | 3300025938 | Bacteria | 2472 |
| 88 | Ga0207691_10008587 | 3300025940 | Bacteria | 9804 |
| 89 | Ga0207689_10002113 | 3300025942 | Bacteria | 18676 |
| 90 | Ga0207667_10001238 | 3300025949 | Bacteria | 32040 |
| 91 | Ga0207667_10003561 | 3300025949 | Bacteria | 19247 |
| 92 | Ga0207667_10054054 | 3300025949 | Bacteria | 4224 |
| 93 | Ga0207651_10019583 | 3300025960 | Bacteria | 4060 |
| 94 | Ga0207640_10073493 | 3300025981 | Unclassified | 2311 |
| 95 | Ga0207658_10206065 | 3300025986 | Bacteria | 1645 |
| 96 | Ga0207677_10018393 | 3300026023 | Bacteria | 4192 |
| 97 | Ga0207639_10093936 | 3300026041 | Bacteria | 2406 |
| 98 | Ga0207648_10002625 | 3300026089 | Bacteria | 19241 |
| 99 | Ga0207674_10013755 | 3300026116 | Bacteria | 8957 |
| 100 | Ga0207675_100169288 | 3300026118 | Bacteria | 2088 |
| 101 | Ga0207683_10039322 | 3300026121 | Bacteria | 4126 |
| 102 | Ga0207698_10013228 | 3300026142 | Bacteria | 5436 |
| 103 | Ga0268266_10000410 | 3300028379 | Bacteria | 65248 |
| 104 | Ga0268266_10042558 | 3300028379 | Bacteria | 3880 |
| 105 | Ga0265338_10014870 | 3300028800 | Bacteria | 8608 |
| 106 | Ga0265338_10028845 | 3300028800 | Bacteria | 5522 |
| 107 | Ga0265338_10044647 | 3300028800 | Bacteria | 4088 |
| 108 | Ga0265332_10012452 | 3300031238 | Bacteria | 3775 |
| 109 | Ga0265329_10001442 | 3300031242 | Bacteria | 11458 |
| 110 | Ga0265339_10006685 | 3300031249 | Bacteria | 7537 |
| 111 | Ga0265331_10005550 | 3300031250 | Bacteria | 7599 |
| 112 | Ga0265316_10064367 | 3300031344 | Bacteria | 2841 |
| 113 | Ga0265313_10007266 | 3300031595 | Bacteria | 7605 |
| 114 | Ga0265314_10000804 | 3300031711 | Bacteria | 37298 |
| 115 | Ga0265314_10010952 | 3300031711 | Bacteria | 7527 |
| 116 | Ga0265342_10011891 | 3300031712 | Bacteria | 5922 |
| 117 | Ga0307405_10007633 | 3300031731 | Bacteria | 5428 |
| 118 | Ga0307412_10074068 | 3300031911 | Unclassified | 2332 |
| 119 | Ga0307412_10108774 | 3300031911 | Bacteria | 1975 |
| 120 | Ga0307409_100080949 | 3300031995 | Unclassified | 2623 |
| 121 | Ga0307416_100132163 | 3300032002 | Unclassified | 2249 |
| 122 | Ga0307414_10062179 | 3300032004 | Bacteria | 2648 |
| 123 | Ga0373935_0047563 | 3300035692 | Bacteria | 2713 |
| 124 | Ga0373927_0017040 | 3300035695 | Bacteria | 4787 |
| 125 | Ga0373947_0004551 | 3300035725 | Bacteria | 8129 |
| 126 | Ga0373925_0003465 | 3300037068 | Bacteria | 12199 |
| 127 | Ga0451577_0002947 | 3300042876 | Bacteria | 19496 |
| 128 | Ga0453683_0000246 | 3300044673 | Bacteria | 72041 |
| 129 | Ga0453684_0008480 | 3300044712 | Bacteria | 18384 |
| 130 | Ga0453684_0017653 | 3300044712 | Bacteria | 11031 |
| 131 | Ga0453684_0056372 | 3300044712 | Archaea | 5098 |
| 132 | Ga0453684_0332188 | 3300044712 | Bacteria | 1719 |
| 133 | Ga0451576_0000090 | 3300045051 | Bacteria | 231703 |
| 134 | Ga0451576_0194737 | 3300045051 | Bacteria | 2117 |
| 135 | Ga0495582_0007004 | 3300046473 | Bacteria | 6270 |
| 136 | Ga0495630_0000077 | 3300046517 | Bacteria | 76692 |
| 137 | Ga0495666_0006916 | 3300046526 | Bacteria | 5697 |
| 138 | Ga0495640_0022741 | 3300046533 | Bacteria | 4578 |
| 139 | Ga0495586_0000044 | 3300046535 | Bacteria | 74379 |
| 140 | Ga0495645_0040110 | 3300046543 | Unclassified | 3415 |
| 141 | Ga0495634_0015469 | 3300046642 | Bacteria | 5483 |
| 142 | Ga0495658_0019112 | 3300046683 | Bacteria | 3572 |
| 143 | Ga0495674_0000586 | 3300047319 | Bacteria | 34088 |
| 144 | Ga0495672_0066637 | 3300047320 | Bacteria | 2054 |
| 145 | Ga0495676_0026204 | 3300047321 | Bacteria | 5021 |
| 146 | Ga0501034_0004779 | 3300049571 | Bacteria | 14988 |
| 147 | Ga0501034_0010765 | 3300049571 | Bacteria | 9500 |
| 148 | Ga0501034_0011027 | 3300049571 | Bacteria | 9383 |
| 149 | Ga0501036_0205662 | 3300049572 | Unclassified | 1655 |
| 150 | Ga0501036_0215581 | 3300049572 | Unclassified | 1613 |
| 151 | Ga0501043_0117018 | 3300049579 | Bacteria | 2091 |
| 152 | Ga0501046_0007480 | 3300049580 | Bacteria | 9591 |
| 153 | Ga0501046_0015576 | 3300049580 | Bacteria | 6386 |
| 154 | Ga0501047_0018686 | 3300049581 | Bacteria | 6646 |
| 155 | Ga0501047_0042967 | 3300049581 | Unclassified | 4367 |
| 156 | Ga0501070_0000890 | 3300049586 | Bacteria | 27159 |
| 157 | Ga0501217_001207 | 3300049661 | Bacteria | 4767 |
| 158 | Ga0501044_0072463 | 3300049823 | Bacteria | 3502 |
| 159 | nmdc:mga09592_44610_c1 | 3300050508 | Bacteria | 3733 |
| 160 | nmdc:mga08y16_190329_c1 | 3300050511 | Unclassified | 2128 |
| 161 | nmdc:mga08y16_26352_c1 | 3300050511 | Bacteria | 6129 |
| 162 | nmdc:mga0rr50_68578_c1 | 3300050513 | Bacteria | 2697 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035692 | Ga0373935_0047563 | Ga0373935_0047563_150_1235 | 361 |
| 2 | 3300009093 | Ga0105240_10014835 | Ga0105240_100148352 | 400 |
| 3 | 3300025913 | Ga0207695_10006159 | Ga0207695_1000615914 | 400 |
| 4 | 3300042876 | Ga0451577_0002947 | Ga0451577_0002947_10707_11918 | 403 |
| 5 | 3300032002 | Ga0307416_100132163 | Ga0307416_1001321632 | 404 |
| 6 | 3300005530 | Ga0070679_100004621 | Ga0070679_1000046215 | 407 |
| 7 | 3300005539 | Ga0068853_100052678 | Ga0068853_1000526783 | 407 |
| 8 | 3300005563 | Ga0068855_100147553 | Ga0068855_1001475532 | 407 |
| 9 | 3300005616 | Ga0068852_100023064 | Ga0068852_1000230642 | 407 |
| 10 | 3300013102 | Ga0157371_10021941 | Ga0157371_100219412 | 407 |
| 11 | 3300013104 | Ga0157370_10054734 | Ga0157370_100547342 | 407 |
| 12 | 3300025909 | Ga0207705_10037277 | Ga0207705_100372773 | 407 |
| 13 | 3300025919 | Ga0207657_10008882 | Ga0207657_100088825 | 407 |
| 14 | 3300025921 | Ga0207652_10066084 | Ga0207652_100660842 | 407 |
| 15 | 3300005841 | Ga0068863_100297245 | Ga0068863_1002972452 | 408 |
| 16 | 3300005617 | Ga0068859_100047133 | Ga0068859_1000471332 | 411 |
| 17 | 3300006931 | Ga0097620_100047133 | Ga0097620_1000471332 | 411 |
| 18 | iso_pu_bacteria | 2687453257 | 2688068675 | 413 |
| 19 | 3300009094 | Ga0111539_10207663 | Ga0111539_102076632 | 414 |
| 20 | 3300050511 | nmdc:mga08y16_190329_c1 | nmdc:mga08y16_190329_c1_603_1853 | 414 |
| 21 | 3300035695 | Ga0373927_0017040 | Ga0373927_0017040_813_2060 | 415 |
| 22 | 3300035725 | Ga0373947_0004551 | Ga0373947_0004551_3832_5079 | 415 |
| 23 | 3300037068 | Ga0373925_0003465 | Ga0373925_0003465_4648_5895 | 415 |
| 24 | 3300049661 | Ga0501217_001207 | Ga0501217_001207_1081_2349 | 415 |
| 25 | 3300006844 | Ga0075428_100011229 | Ga0075428_1000112296 | 416 |
| 26 | 3300006844 | Ga0075428_100053057 | Ga0075428_1000530573 | 416 |
| 27 | 3300006880 | Ga0075429_100050405 | Ga0075429_1000504051 | 416 |
| 28 | 3300009094 | Ga0111539_10032535 | Ga0111539_100325353 | 416 |
| 29 | 3300009094 | Ga0111539_10204263 | Ga0111539_102042631 | 416 |
| 30 | 3300013296 | Ga0157374_10103457 | Ga0157374_101034573 | 416 |
| 31 | 3300031242 | Ga0265329_10001442 | Ga0265329_100014425 | 416 |
| 32 | 3300031344 | Ga0265316_10064367 | Ga0265316_100643672 | 416 |
| 33 | 3300031711 | Ga0265314_10000804 | Ga0265314_1000080426 | 416 |
| 34 | 3300049579 | Ga0501043_0117018 | Ga0501043_0117018_377_1675 | 416 |
| 35 | 3300049580 | Ga0501046_0015576 | Ga0501046_0015576_4386_5684 | 416 |
| 36 | 3300049581 | Ga0501047_0042967 | Ga0501047_0042967_1736_3034 | 416 |
| 37 | 3300049586 | Ga0501070_0000890 | Ga0501070_0000890_11206_12504 | 416 |
| 38 | 3300050508 | nmdc:mga09592_44610_c1 | nmdc:mga09592_44610_c1_345_1595 | 416 |
| 39 | 3300050511 | nmdc:mga08y16_26352_c1 | nmdc:mga08y16_26352_c1_3596_4909 | 416 |
| 40 | 3300005436 | Ga0070713_100034907 | Ga0070713_1000349074 | 417 |
| 41 | 3300005444 | Ga0070694_100002828 | Ga0070694_1000028285 | 417 |
| 42 | 3300005544 | Ga0070686_100060150 | Ga0070686_1000601501 | 417 |
| 43 | 3300005563 | Ga0068855_100009370 | Ga0068855_1000093702 | 417 |
| 44 | 3300005578 | Ga0068854_100091864 | Ga0068854_1000918642 | 417 |
| 45 | 3300014325 | Ga0163163_10000167 | Ga0163163_1000016755 | 417 |
| 46 | 3300025949 | Ga0207667_10054054 | Ga0207667_100540543 | 417 |
| 47 | 3300025981 | Ga0207640_10073493 | Ga0207640_100734932 | 417 |
| 48 | 3300028800 | Ga0265338_10014870 | Ga0265338_100148702 | 417 |
| 49 | 3300005295 | Ga0065707_10085165 | Ga0065707_100851656 | 418 |
| 50 | 3300005441 | Ga0070700_100043495 | Ga0070700_1000434952 | 418 |
| 51 | 3300005563 | Ga0068855_100005361 | Ga0068855_10000536112 | 418 |
| 52 | 3300005577 | Ga0068857_100010498 | Ga0068857_1000104987 | 418 |
| 53 | 3300013308 | Ga0157375_10000033 | Ga0157375_1000003351 | 418 |
| 54 | 3300025949 | Ga0207667_10003561 | Ga0207667_100035615 | 418 |
| 55 | 3300046543 | Ga0495645_0040110 | Ga0495645_0040110_377_1636 | 418 |
| 56 | iso_pu_bacteria | 2920107658 | 2920109054 | 418 |
| 57 | 3300005617 | Ga0068859_100186809 | Ga0068859_1001868091 | 419 |
| 58 | 3300006931 | Ga0097620_100186808 | Ga0097620_1001868081 | 419 |
| 59 | 3300009098 | Ga0105245_10022758 | Ga0105245_100227586 | 419 |
| 60 | 3300009551 | Ga0105238_10000329 | Ga0105238_1000032918 | 419 |
| 61 | 3300013307 | Ga0157372_10056685 | Ga0157372_100566852 | 419 |
| 62 | 3300025924 | Ga0207694_10002407 | Ga0207694_100024075 | 419 |
| 63 | 3300028800 | Ga0265338_10028845 | Ga0265338_100288453 | 419 |
| 64 | 3300031238 | Ga0265332_10012452 | Ga0265332_100124523 | 419 |
| 65 | 3300031249 | Ga0265339_10006685 | Ga0265339_100066853 | 419 |
| 66 | 3300031250 | Ga0265331_10005550 | Ga0265331_100055503 | 419 |
| 67 | 3300031595 | Ga0265313_10007266 | Ga0265313_100072663 | 419 |
| 68 | 3300031711 | Ga0265314_10010952 | Ga0265314_100109526 | 419 |
| 69 | 3300031712 | Ga0265342_10011891 | Ga0265342_100118913 | 419 |
| 70 | 3300044712 | Ga0453684_0008480 | Ga0453684_0008480_10798_12066 | 419 |
| 71 | 3300044712 | Ga0453684_0017653 | Ga0453684_0017653_2669_3946 | 419 |
| 72 | 3300044712 | Ga0453684_0332188 | Ga0453684_0332188_393_1700 | 419 |
| 73 | 3300045051 | Ga0451576_0194737 | Ga0451576_0194737_690_1949 | 419 |
| 74 | 3300046473 | Ga0495582_0007004 | Ga0495582_0007004_57_1328 | 419 |
| 75 | 3300046517 | Ga0495630_0000077 | Ga0495630_0000077_24671_25942 | 419 |
| 76 | 3300046526 | Ga0495666_0006916 | Ga0495666_0006916_4416_5687 | 419 |
| 77 | 3300046533 | Ga0495640_0022741 | Ga0495640_0022741_2913_4184 | 419 |
| 78 | 3300046535 | Ga0495586_0000044 | Ga0495586_0000044_22311_23582 | 419 |
| 79 | 3300046642 | Ga0495634_0015469 | Ga0495634_0015469_1577_2848 | 419 |
| 80 | 3300046683 | Ga0495658_0019112 | Ga0495658_0019112_417_1688 | 419 |
| 81 | 3300047319 | Ga0495674_0000586 | Ga0495674_0000586_20430_21701 | 419 |
| 82 | 3300047321 | Ga0495676_0026204 | Ga0495676_0026204_1727_2998 | 419 |
| 83 | 3300005365 | Ga0070688_100126142 | Ga0070688_1001261421 | 420 |
| 84 | 3300005539 | Ga0068853_100002231 | Ga0068853_1000022316 | 420 |
| 85 | 3300005548 | Ga0070665_100000302 | Ga0070665_10000030215 | 420 |
| 86 | 3300005617 | Ga0068859_100071774 | Ga0068859_1000717745 | 420 |
| 87 | 3300005841 | Ga0068863_100029206 | Ga0068863_1000292067 | 420 |
| 88 | 3300006042 | Ga0075368_10035741 | Ga0075368_100357412 | 420 |
| 89 | 3300006931 | Ga0097620_100071774 | Ga0097620_1000717741 | 420 |
| 90 | 3300025936 | Ga0207670_10001166 | Ga0207670_1000116612 | 420 |
| 91 | 3300028379 | Ga0268266_10000410 | Ga0268266_1000041046 | 420 |
| 92 | 3300028800 | Ga0265338_10044647 | Ga0265338_100446472 | 420 |
| 93 | 3300049571 | Ga0501034_0004779 | Ga0501034_0004779_11881_13176 | 420 |
| 94 | 3300049572 | Ga0501036_0205662 | Ga0501036_0205662_250_1545 | 420 |
| 95 | 3300049580 | Ga0501046_0007480 | Ga0501046_0007480_3152_4447 | 420 |
| 96 | 3300049581 | Ga0501047_0018686 | Ga0501047_0018686_1685_2980 | 420 |
| 97 | 3300005336 | Ga0070680_100161109 | Ga0070680_1001611092 | 421 |
| 98 | 3300005366 | Ga0070659_100008396 | Ga0070659_1000083964 | 421 |
| 99 | 3300005458 | Ga0070681_10114344 | Ga0070681_101143442 | 421 |
| 100 | 3300013105 | Ga0157369_10030955 | Ga0157369_100309552 | 421 |
| 101 | 3300025912 | Ga0207707_10134728 | Ga0207707_101347281 | 421 |
| 102 | 3300025919 | Ga0207657_10010419 | Ga0207657_100104192 | 421 |
| 103 | 3300025921 | Ga0207652_10091750 | Ga0207652_100917503 | 421 |
| 104 | 3300026041 | Ga0207639_10093936 | Ga0207639_100939362 | 421 |
| 105 | iso_pu_bacteria | 2522125168 | 2522547698 | 421 |
| 106 | 3300005334 | Ga0068869_100186775 | Ga0068869_1001867751 | 422 |
| 107 | 3300005334 | Ga0068869_100208118 | Ga0068869_1002081181 | 422 |
| 108 | 3300007076 | Ga0075435_100077947 | Ga0075435_1000779472 | 422 |
| 109 | 3300025938 | Ga0207704_10052494 | Ga0207704_100524942 | 422 |
| 110 | 3300044673 | Ga0453683_0000246 | Ga0453683_0000246_64036_65307 | 422 |
| 111 | 3300044712 | Ga0453684_0056372 | Ga0453684_0056372_2469_3740 | 422 |
| 112 | 3300045051 | Ga0451576_0000090 | Ga0451576_0000090_166405_167676 | 422 |
| 113 | 3300050513 | nmdc:mga0rr50_68578_c1 | nmdc:mga0rr50_68578_c1_759_2030 | 422 |
| 114 | 3300005563 | Ga0068855_100058750 | Ga0068855_1000587502 | 423 |
| 115 | 3300005577 | Ga0068857_100007425 | Ga0068857_1000074253 | 423 |
| 116 | 3300009551 | Ga0105238_10004631 | Ga0105238_100046315 | 423 |
| 117 | 3300013102 | Ga0157371_10025236 | Ga0157371_100252362 | 423 |
| 118 | 3300013104 | Ga0157370_10177894 | Ga0157370_101778941 | 423 |
| 119 | 3300013105 | Ga0157369_10136239 | Ga0157369_101362392 | 423 |
| 120 | 3300013307 | Ga0157372_10002881 | Ga0157372_1000288110 | 423 |
| 121 | 3300025913 | Ga0207695_10024977 | Ga0207695_100249774 | 423 |
| 122 | 3300025949 | Ga0207667_10001238 | Ga0207667_1000123812 | 423 |
| 123 | 3300026116 | Ga0207674_10013755 | Ga0207674_100137553 | 423 |
| 124 | 3300026142 | Ga0207698_10013228 | Ga0207698_100132283 | 423 |
| 125 | 3300031911 | Ga0307412_10074068 | Ga0307412_100740682 | 423 |
| 126 | 3300031995 | Ga0307409_100080949 | Ga0307409_1000809492 | 423 |
| 127 | 3300049571 | Ga0501034_0010765 | Ga0501034_0010765_4523_5872 | 423 |
| 128 | 3300049571 | Ga0501034_0011027 | Ga0501034_0011027_6834_8111 | 423 |
| 129 | 3300049572 | Ga0501036_0215581 | Ga0501036_0215581_98_1375 | 423 |
| 130 | 3300049823 | Ga0501044_0072463 | Ga0501044_0072463_1830_3107 | 423 |
| 131 | 3300005328 | Ga0070676_10009514 | Ga0070676_100095143 | 424 |
| 132 | 3300005338 | Ga0068868_100009027 | Ga0068868_1000090273 | 424 |
| 133 | 3300005353 | Ga0070669_100015071 | Ga0070669_1000150712 | 424 |
| 134 | 3300005354 | Ga0070675_100025402 | Ga0070675_1000254022 | 424 |
| 135 | 3300005364 | Ga0070673_100050713 | Ga0070673_1000507132 | 424 |
| 136 | 3300005456 | Ga0070678_100072387 | Ga0070678_1000723872 | 424 |
| 137 | 3300005543 | Ga0070672_100072024 | Ga0070672_1000720242 | 424 |
| 138 | 3300005548 | Ga0070665_100152118 | Ga0070665_1001521182 | 424 |
| 139 | 3300005617 | Ga0068859_100058709 | Ga0068859_1000587092 | 424 |
| 140 | 3300005840 | Ga0068870_10038159 | Ga0068870_100381592 | 424 |
| 141 | 3300006237 | Ga0097621_100037809 | Ga0097621_1000378093 | 424 |
| 142 | 3300006931 | Ga0097620_100058706 | Ga0097620_1000587062 | 424 |
| 143 | 3300009098 | Ga0105245_10201046 | Ga0105245_102010462 | 424 |
| 144 | 3300011119 | Ga0105246_10075948 | Ga0105246_100759482 | 424 |
| 145 | 3300025901 | Ga0207688_10030663 | Ga0207688_100306632 | 424 |
| 146 | 3300025938 | Ga0207704_10044078 | Ga0207704_100440782 | 424 |
| 147 | 3300025940 | Ga0207691_10008587 | Ga0207691_100085872 | 424 |
| 148 | 3300025942 | Ga0207689_10002113 | Ga0207689_1000211317 | 424 |
| 149 | 3300025960 | Ga0207651_10019583 | Ga0207651_100195833 | 424 |
| 150 | 3300025986 | Ga0207658_10206065 | Ga0207658_102060652 | 424 |
| 151 | 3300026023 | Ga0207677_10018393 | Ga0207677_100183932 | 424 |
| 152 | 3300026089 | Ga0207648_10002625 | Ga0207648_100026256 | 424 |
| 153 | 3300026118 | Ga0207675_100169288 | Ga0207675_1001692882 | 424 |
| 154 | 3300026121 | Ga0207683_10039322 | Ga0207683_100393222 | 424 |
| 155 | 3300028379 | Ga0268266_10042558 | Ga0268266_100425583 | 424 |
| 156 | 3300047320 | Ga0495672_0066637 | Ga0495672_0066637_461_1735 | 424 |
| 157 | 3300003781 | Ga0055536_1009905 | Ga0055536_10099052 | 425 |
| 158 | 3300005262 | Ga0065165_1000226 | Ga0065165_100022622 | 425 |
| 159 | 3300005339 | Ga0070660_100004409 | Ga0070660_1000044097 | 425 |
| 160 | 3300005843 | Ga0068860_100048990 | Ga0068860_1000489902 | 425 |
| 161 | 3300025292 | Ga0209676_1001032 | Ga0209676_100103222 | 425 |
| 162 | 3300025919 | Ga0207657_10093705 | Ga0207657_100937051 | 425 |
| 163 | 3300031731 | Ga0307405_10007633 | Ga0307405_100076332 | 425 |
| 164 | 3300031911 | Ga0307412_10108774 | Ga0307412_101087742 | 425 |
| 165 | 3300032004 | Ga0307414_10062179 | Ga0307414_100621792 | 425 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wgk-assembly1.cif.gz_A | crystal structure of human neutral ceramidase with zn-bound phosphate | 0.7777 | 23 | 415 |
| 2zws-assembly1.cif.gz_A | crystal structure analysis of neutral ceramidase from pseudomonas aeruginosa | 0.7766 | 21 | 424 |
| 4wgk-assembly2.cif.gz_B | crystal structure of human neutral ceramidase with zn-bound phosphate | 0.7718 | 22 | 415 |
| 2zxc-assembly2.cif.gz_B | ceramidase complexed with c2 | 0.7601 | 21 | 424 |
| 2zws-assembly1.cif.gz_A | crystal structure analysis of neutral ceramidase from pseudomonas aeruginosa | 0.7412 | 21 | 424 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ws9B02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;S-adenosylmethionine synthetase, N-terminal domain | 0.7926 | 60 | 77 | 3.30.300.340 |
| af_A0A1D8PFG6_11_164_3.30.230.90 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.6265 | 26 | 77 | 3.30.230.90 |
| 3imlB01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.6254 | 175 | 202 | 3.30.300.10 |
| 1jpdX01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.6232 | 21 | 77 | 3.30.390.10 |
| af_Q60269_1_415_3.30.2170.10 | Alpha Beta;2-Layer Sandwich;archaeoglobus fulgidus dsm 4304 fold;archaeoglobus fulgidus dsm 4304 superfamily | 0.6145 | 21 | 77 | 3.30.2170.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A316E2G9-F1-model_v4 | Neutral/alkaline ceramidase-like enzyme | 0.9879 | 21 | 424 |
GO:0016020
|
| AF-A0A6G3ZCQ9-F1-model_v4 | Neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein | 0.9864 | 21 | 355 |
|
| AF-A0A3C0UY26-F1-model_v4 | Neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein | 0.9828 | 21 | 315 |
|
| AF-A0A3C1UR21-F1-model_v4 | Neutral/alkaline non-lysosomal ceramidase N-terminal domain-containing protein | 0.9821 | 22 | 289 |
|
| AF-X1M8R6-F1-model_v4 | DUF362 domain-containing protein | 0.9819 | 149 | 414 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar