F246033

General Info

Members Datasets Scaffolds Average Seq Length
165 134 330 108

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10989002|Ga0105247_109890022
Length 110
Sequence VTIMPSIHFVHPDKRSEPVAAKVGDSVMQVATGHGVDGIVAECGGNAMCATCHVYVDEGWLPRLAAMSTEENELLDGVAAERQPNSRLSCQIKVTPELDGLVVRLPDRQI

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
55 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
58 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
70 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
71 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
72 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
80 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
81 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
109 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
121 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
122 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
123 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
124 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
125 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
126 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
128 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
129 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
130 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
131 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
132 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
133 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
134 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 0
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.76
Nodule 3.64
Rhizoplane 6.67
Rhizosphere 65.45
Stem 0
Stem Tuber 0
Unclassified 5.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10989002 3300009101 Bacteria 656
2 Ga0070690_100770687 3300005330 Bacteria 744
3 Ga0068869_100401430 3300005334 Bacteria 1127
4 Ga0070675_101211357 3300005354 Bacteria 695
5 Ga0070675_101384006 3300005354 Bacteria 649
6 Ga0070708_100191307 3300005445 Bacteria 1914
7 Ga0070678_100171699 3300005456 Bacteria 1767
8 Ga0068867_101749992 3300005459 Bacteria 584
9 Ga0068853_100866876 3300005539 Bacteria 866
10 Ga0070672_101301891 3300005543 Bacteria 649
11 Ga0070672_101947360 3300005543 Bacteria 529
12 Ga0070665_100665802 3300005548 Unclassified 1054
13 Ga0081538_10003835 3300005981 Bacteria 14043
14 Ga0081538_10085665 3300005981 Bacteria 1654
15 Ga0081540_1007755 3300005983 Bacteria 7602
16 Ga0081540_1104084 3300005983 Bacteria 1216
17 Ga0081540_1209658 3300005983 Bacteria 702
18 Ga0075365_10325217 3300006038 Bacteria 1083
19 Ga0075365_10998127 3300006038 Bacteria 590
20 Ga0075363_100232020 3300006048 Bacteria 1060
21 Ga0075364_10457504 3300006051 Bacteria 872
22 Ga0075362_10156142 3300006177 Bacteria 1097
23 Ga0075367_10030159 3300006178 Bacteria 3107
24 Ga0075367_10492447 3300006178 Bacteria 777
25 Ga0075366_10048455 3300006195 Bacteria 2520
26 Ga0097621_100293530 3300006237 Bacteria 1434
27 Ga0075370_10104242 3300006353 Bacteria 1643
28 Ga0068871_100260427 3300006358 Bacteria 1513
29 Ga0075430_100217220 3300006846 Bacteria 1586
30 Ga0075433_10053668 3300006852 Bacteria 3515
31 Ga0068865_100176562 3300006881 Bacteria 1642
32 Ga0075435_100482684 3300007076 Bacteria 1071
33 Ga0099795_10426667 3300007788 Bacteria 607
34 Ga0105244_10029836 3300009036 Bacteria 2908
35 Ga0111539_10135982 3300009094 Bacteria 2878
36 Ga0111539_12817501 3300009094 Unclassified 563
37 Ga0105245_11694804 3300009098 Bacteria 684
38 Ga0114129_11155453 3300009147 Bacteria 966
39 Ga0105242_10964701 3300009176 Bacteria 858
40 Ga0099796_10177448 3300010159 Bacteria 853
41 Ga0099796_10232937 3300010159 Bacteria 759
42 Ga0105246_10018013 3300011119 Bacteria 4499
43 Ga0157374_11476147 3300013296 Unclassified 703
44 Ga0163162_12096024 3300013306 Bacteria 649
45 Ga0163162_12317318 3300013306 Unclassified 617
46 Ga0157375_10350490 3300013308 Bacteria 1642
47 Ga0163163_10336582 3300014325 Bacteria 1564
48 Ga0163163_11466497 3300014325 Bacteria 744
49 Ga0163163_13346167 3300014325 Unclassified 500
50 Ga0157380_11128908 3300014326 Bacteria 824
51 Ga0157376_10862904 3300014969 Bacteria 921
52 Ga0157376_12824891 3300014969 Unclassified 525
53 Ga0163161_10076580 3300017792 Bacteria 2455
54 Ga0213872_10020611 3300021361 Bacteria 3039
55 Ga0213871_10000581 3300021441 Bacteria 5152
56 Ga0213871_10102148 3300021441 Bacteria 840
57 Ga0207697_10298781 3300025315 Bacteria 714
58 Ga0207655_1166625 3300025728 Unclassified 684
59 Ga0207646_11354996 3300025922 Bacteria 620
60 Ga0207659_11586645 3300025926 Bacteria 559
61 Ga0207687_11214065 3300025927 Bacteria 648
62 Ga0207686_10806910 3300025934 Bacteria 753
63 Ga0207665_10722065 3300025939 Bacteria 784
64 Ga0207711_10720165 3300025941 Viruses 930
65 Ga0207639_10411814 3300026041 Bacteria 1220
66 Ga0207676_11060190 3300026095 Unclassified 800
67 Ga0207683_10030314 3300026121 Bacteria 4686
68 Ga0207428_10445819 3300027907 Bacteria 944
69 Ga0207428_11081213 3300027907 Bacteria 561
70 Ga0307517_10011851 3300028786 Bacteria 12042
71 Ga0307517_10460622 3300028786 Bacteria 656
72 Ga0307515_10049152 3300028794 Bacteria 6356
73 Ga0307513_10019516 3300031456 Bacteria 8071
74 Ga0307509_10099082 3300031507 Bacteria 2957
75 Ga0307408_100062071 3300031548 Bacteria 2730
76 Ga0307508_10041439 3300031616 Bacteria 4133
77 Ga0307516_10017190 3300031730 Bacteria 7549
78 Ga0307516_10227276 3300031730 Bacteria 1572
79 Ga0307516_10283993 3300031730 Bacteria 1336
80 Ga0307405_10883937 3300031731 Bacteria 755
81 Ga0307405_11267598 3300031731 Unclassified 640
82 Ga0307416_100587636 3300032002 Bacteria 1192
83 Ga0307510_10011621 3300033180 Bacteria 10452
84 Ga0307510_10041033 3300033180 Bacteria 5068
85 Ga0307510_10078877 3300033180 Bacteria 3216
86 Ga0373954_0200824 3300035118 Bacteria 980
87 Ga0373955_1029255 3300035172 Bacteria 507
88 Ga0436360_0179345 3300039438 Bacteria 886
89 Ga0436360_1022466 3300039438 Bacteria 3439
90 Ga0436360_1104326 3300039438 Bacteria 734
91 Ga0436361_0143973 3300039447 Bacteria 567
92 Ga0436361_0276770 3300039447 Bacteria 1527
93 Ga0436361_0475993 3300039447 Bacteria 1614
94 Ga0436361_0935365 3300039447 Bacteria 4184
95 Ga0436362_0209271 3300039453 Bacteria 2054
96 Ga0451797_1308738 3300041453 Bacteria 673
97 Ga0451800_0927285 3300041459 Viruses 757
98 Ga0451843_1620896 3300041509 Bacteria 653
99 Ga0495603_0107126 3300046455 Bacteria 1631
100 Ga0495629_0959633 3300046459 Bacteria 558
101 Ga0495641_0040124 3300046461 Bacteria 2178
102 Ga0495651_0235630 3300046462 Bacteria 1258
103 Ga0495605_0193129 3300046474 Bacteria 890
104 Ga0495594_0098049 3300046499 Bacteria 1647
105 Ga0495631_0487751 3300046518 Bacteria 525
106 Ga0495663_0367988 3300046525 Bacteria 525
107 Ga0495622_0045290 3300046557 Bacteria 2044
108 Ga0495656_0125127 3300046615 Bacteria 1218
109 Ga0495625_0215044 3300046660 Bacteria 1262
110 Ga0495658_1008522 3300046683 Bacteria 531
111 Ga0495624_0414132 3300046690 Bacteria 808
112 Ga0495581_0064942 3300047315 Bacteria 2109
113 Ga0495672_0119591 3300047320 Bacteria 1402
114 Ga0495676_0460279 3300047321 Bacteria 838
115 Ga0495675_0510829 3300047444 Bacteria 689
116 Ga0496101_0293612 3300048904 Bacteria 1272
117 Ga0496105_1379375 3300048908 Bacteria 511
118 Ga0496106_1373877 3300048909 Bacteria 546
119 Ga0496107_0351931 3300048910 Bacteria 1096
120 Ga0496109_0567342 3300048912 Bacteria 1070
121 Ga0496110_0117038 3300048913 Bacteria 2400
122 Ga0496112_0675403 3300048915 Bacteria 962
123 Ga0496114_0381475 3300048917 Bacteria 1248
124 Ga0496114_1208520 3300048917 Bacteria 642
125 Ga0496121_0022781 3300048924 Bacteria 6058
126 Ga0495682_0346025 3300049460 Bacteria 524
127 Ga0501033_0767559 3300049570 Bacteria 653
128 Ga0501034_1291322 3300049571 Bacteria 607
129 Ga0501071_0927552 3300049587 Bacteria 672
130 Ga0501072_0477932 3300049588 Bacteria 986
131 Ga0501075_0429185 3300049591 Bacteria 1008
132 Ga0501076_0491939 3300049592 Bacteria 1011
133 Ga0501076_0769218 3300049592 Bacteria 795
134 Ga0501077_0916526 3300049593 Bacteria 564
135 Ga0501080_1262067 3300049742 Bacteria 634
136 nmdc:mga03683_30260_c2 3300050489 Bacteria 765
137 nmdc:mga03n38_258463_c1 3300050490 Bacteria 922
138 nmdc:mga0yw44_841599_c1 3300050492 Bacteria 623
139 nmdc:mga0k408_269226_c1 3300050493 Bacteria 1017
140 nmdc:mga06z11_411446_c1 3300050494 Bacteria 815
141 nmdc:mga06z11_784415_c1 3300050494 Bacteria 581
142 nmdc:mga07m45_7696_c1 3300050496 Bacteria 4509
143 nmdc:mga05p37_1448512_c1 3300050507 Bacteria 688
144 nmdc:mga0qj67_55322_c2 3300050509 Bacteria 2720
145 nmdc:mga06r32_882148_c1 3300050510 Bacteria 852
146 nmdc:mga08y16_559394_c1 3300050511 Bacteria 1157
147 nmdc:mga0a205_67148_c1 3300050515 Bacteria 3464
148 nmdc:mga0sz30_241752_c1 3300050516 Bacteria 803
149 Ga0500566_0298687 3300053094 Bacteria 759
150 Ga0500595_000714 3300053119 Bacteria 19783
151 Ga0500595_040600 3300053119 Bacteria 1499
152 Ga0500614_222942 3300053123 Bacteria 584
153 Ga0500652_000006 3300053131 Bacteria 167437
154 Ga0500604_0196035 3300053151 Bacteria 694
155 Ga0500636_0004476 3300053177 Bacteria 7913
156 Ga0500636_0017110 3300053177 Bacteria 4277
157 Ga0500611_072088 3300053727 Bacteria 844
158 Ga0501084_0639454 3300054114 Bacteria 898
159 2513694878 2513237101 Bacteria 7952346
160 2841944420 2841941048 Bacteria 8688029
161 2841982862 2841974524 Bacteria 8931498
162 2860339431 2860339153 Bacteria 6846989
163 2874610314 2874604998 Bacteria 7834745
164 2922366913 2922361189 Bacteria 7436256
165 8007000293 8006994254 Bacteria 8309700
166 Ga0105247_10989002
167 Ga0070690_100770687
168 Ga0068869_100401430
169 Ga0070675_101211357
170 Ga0070675_101384006
171 Ga0070708_100191307
172 Ga0070678_100171699
173 Ga0068867_101749992
174 Ga0068853_100866876
175 Ga0070672_101301891
176 Ga0070672_101947360
177 Ga0070665_100665802
178 Ga0081538_10003835
179 Ga0081538_10085665
180 Ga0081540_1007755
181 Ga0081540_1104084
182 Ga0081540_1209658
183 Ga0075365_10325217
184 Ga0075365_10998127
185 Ga0075363_100232020
186 Ga0075364_10457504
187 Ga0075362_10156142
188 Ga0075367_10030159
189 Ga0075367_10492447
190 Ga0075366_10048455
191 Ga0097621_100293530
192 Ga0075370_10104242
193 Ga0068871_100260427
194 Ga0075430_100217220
195 Ga0075433_10053668
196 Ga0068865_100176562
197 Ga0075435_100482684
198 Ga0099795_10426667
199 Ga0105244_10029836
200 Ga0111539_10135982
201 Ga0111539_12817501
202 Ga0105245_11694804
203 Ga0114129_11155453
204 Ga0105242_10964701
205 Ga0099796_10177448
206 Ga0099796_10232937
207 Ga0105246_10018013
208 Ga0157374_11476147
209 Ga0163162_12096024
210 Ga0163162_12317318
211 Ga0157375_10350490
212 Ga0163163_10336582
213 Ga0163163_11466497
214 Ga0163163_13346167
215 Ga0157380_11128908
216 Ga0157376_10862904
217 Ga0157376_12824891
218 Ga0163161_10076580
219 Ga0213872_10020611
220 Ga0213871_10000581
221 Ga0213871_10102148
222 Ga0207697_10298781
223 Ga0207655_1166625
224 Ga0207646_11354996
225 Ga0207659_11586645
226 Ga0207687_11214065
227 Ga0207686_10806910
228 Ga0207665_10722065
229 Ga0207711_10720165
230 Ga0207639_10411814
231 Ga0207676_11060190
232 Ga0207683_10030314
233 Ga0207428_10445819
234 Ga0207428_11081213
235 Ga0307517_10011851
236 Ga0307517_10460622
237 Ga0307515_10049152
238 Ga0307513_10019516
239 Ga0307509_10099082
240 Ga0307408_100062071
241 Ga0307508_10041439
242 Ga0307516_10017190
243 Ga0307516_10227276
244 Ga0307516_10283993
245 Ga0307405_10883937
246 Ga0307405_11267598
247 Ga0307416_100587636
248 Ga0307510_10011621
249 Ga0307510_10041033
250 Ga0307510_10078877
251 Ga0373954_0200824
252 Ga0373955_1029255
253 Ga0436360_0179345
254 Ga0436360_1022466
255 Ga0436360_1104326
256 Ga0436361_0143973
257 Ga0436361_0276770
258 Ga0436361_0475993
259 Ga0436361_0935365
260 Ga0436362_0209271
261 Ga0451797_1308738
262 Ga0451800_0927285
263 Ga0451843_1620896
264 Ga0495603_0107126
265 Ga0495629_0959633
266 Ga0495641_0040124
267 Ga0495651_0235630
268 Ga0495605_0193129
269 Ga0495594_0098049
270 Ga0495631_0487751
271 Ga0495663_0367988
272 Ga0495622_0045290
273 Ga0495656_0125127
274 Ga0495625_0215044
275 Ga0495658_1008522
276 Ga0495624_0414132
277 Ga0495581_0064942
278 Ga0495672_0119591
279 Ga0495676_0460279
280 Ga0495675_0510829
281 Ga0496101_0293612
282 Ga0496105_1379375
283 Ga0496106_1373877
284 Ga0496107_0351931
285 Ga0496109_0567342
286 Ga0496110_0117038
287 Ga0496112_0675403
288 Ga0496114_0381475
289 Ga0496114_1208520
290 Ga0496121_0022781
291 Ga0495682_0346025
292 Ga0501033_0767559
293 Ga0501034_1291322
294 Ga0501071_0927552
295 Ga0501072_0477932
296 Ga0501075_0429185
297 Ga0501076_0491939
298 Ga0501076_0769218
299 Ga0501077_0916526
300 Ga0501080_1262067
301 nmdc:mga03683_30260_c2
302 nmdc:mga03n38_258463_c1
303 nmdc:mga0yw44_841599_c1
304 nmdc:mga0k408_269226_c1
305 nmdc:mga06z11_411446_c1
306 nmdc:mga06z11_784415_c1
307 nmdc:mga07m45_7696_c1
308 nmdc:mga05p37_1448512_c1
309 nmdc:mga0qj67_55322_c2
310 nmdc:mga06r32_882148_c1
311 nmdc:mga08y16_559394_c1
312 nmdc:mga0a205_67148_c1
313 nmdc:mga0sz30_241752_c1
314 Ga0500566_0298687
315 Ga0500595_000714
316 Ga0500595_040600
317 Ga0500614_222942
318 Ga0500652_000006
319 Ga0500604_0196035
320 Ga0500636_0004476
321 Ga0500636_0017110
322 Ga0500611_072088
323 Ga0501084_0639454
324 2513694878
325 2841944420
326 2841982862
327 2860339431
328 2874610314
329 2922366913
330 8007000293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

10

95

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.9943 1 106
1uwm-assembly1.cif.gz_A reduced ferredoxin 6 from rhodobacter capsulatus 0.9855 3 106
3hui-assembly1.cif.gz_A crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris 0.9851 1 106
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.9823 1 106
1r7s-assembly3.cif.gz_C putidaredoxin (fe2s2 ferredoxin), c73g mutant 0.9802 3 106
ID Description Score Start End Superfamily
1uwmA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9855 3 106 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9796 2 106 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9696 2 105 3.10.20.30
af_A4I234_54_172_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.961 2 105 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9566 3 102 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A512JJY0-F1-model_v4 (2Fe-2S) ferredoxin 1.007 1 106 GO:0009055
GO:0051537
GO:0140647
AF-A0A3S1VV72-F1-model_v4 deleted 1.006 22 106
AF-A0A177IQL7-F1-model_v4 Ferredoxin 2Fe-2S 1.005 1 106 GO:0009055
GO:0051537
GO:0140647
AF-A0A1A6FTP8-F1-model_v4 2Fe-2S ferredoxin 1.005 2 106 GO:0009055
GO:0051537
GO:0140647
AF-A0A654B8P4-F1-model_v4 Ferredoxin, 2Fe-2S 1.005 1 106 GO:0005829
GO:0009055
GO:0051537
GO:0140647

Map