F245423

General Info

Members Datasets Scaffolds Average Seq Length
165 131 330 144

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100083491|Ga0070682_1000834911
Length 168
Sequence LTTGDGRAKSKGVTKAAAKKPVRATQRRRVAAKPVLLAGGNPQIAKGEGNAPVKAFIAAMPGWKRAVGRRLDALIARTVPGVKKAVKWNSPFYGVEGQGWFLNFHCFTSYIKLAFFRGASLRPAPPGASKHKEVRYVDVYEDDELDEKQLASWIRQAAAIPGWDGKSG

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
88 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
91 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
92 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
93 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
98 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
106 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
107 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
108 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
115 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
120 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
121 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
122 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
125 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
126 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
127 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
128 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
130 2643221688 Rhizobium sp. Root482 Isolate Unclassified
131 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 0
Isolates 1.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.27
Nodule 0
Rhizoplane 1.21
Rhizosphere 87.27
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100083491 3300005337 Bacteria 2073
2 SwRhRL2b_contig_3050460 2162886007 Bacteria 835
3 JGI24748J21848_1000005 3300002074 Bacteria 228924
4 JGI24034J26672_10000003 3300002239 Bacteria 501747
5 JGI24742J22300_10006582 3300002244 Bacteria 1917
6 JGI25406J46586_10045925 3300003203 Bacteria 1500
7 rootH1_10037172 3300003316 Bacteria 1846
8 Ga0065704_10097212 3300005289 Bacteria 2362
9 Ga0065707_10007749 3300005295 Bacteria 6030
10 Ga0065707_10168561 3300005295 Bacteria 1500
11 Ga0065707_10220760 3300005295 Bacteria 1224
12 Ga0070670_101005838 3300005331 Bacteria 758
13 Ga0070677_10248650 3300005333 Bacteria 881
14 Ga0070682_100009991 3300005337 Bacteria 5374
15 Ga0070689_100929346 3300005340 Bacteria 771
16 Ga0070689_101049464 3300005340 Bacteria 727
17 Ga0070691_10296594 3300005341 Bacteria 882
18 Ga0070687_100623363 3300005343 Bacteria 744
19 Ga0070692_10872761 3300005345 Bacteria 620
20 Ga0070669_100525026 3300005353 Bacteria 985
21 Ga0070675_102220119 3300005354 Bacteria 506
22 Ga0070674_100998935 3300005356 Bacteria 734
23 Ga0070673_100876237 3300005364 Bacteria 832
24 Ga0070688_100346099 3300005365 Bacteria 1087
25 Ga0070667_100300960 3300005367 Bacteria 1444
26 Ga0070700_100163351 3300005441 Bacteria 1535
27 Ga0070694_100524940 3300005444 Bacteria 945
28 Ga0070678_100039671 3300005456 Bacteria 3325
29 Ga0070685_10002185 3300005466 Bacteria 10101
30 Ga0070707_100192096 3300005468 Bacteria 1991
31 Ga0070698_100143867 3300005471 Bacteria 2334
32 Ga0070698_100163801 3300005471 Bacteria 2167
33 Ga0070699_100013313 3300005518 Bacteria 7094
34 Ga0070686_100383166 3300005544 Bacteria 1065
35 Ga0070695_100062952 3300005545 Bacteria 2410
36 Ga0070695_100143722 3300005545 Bacteria 1657
37 Ga0070665_100605091 3300005548 Bacteria 1109
38 Ga0070704_100216701 3300005549 Bacteria 1554
39 Ga0070704_101148676 3300005549 Bacteria 707
40 Ga0070702_100933174 3300005615 Bacteria 682
41 Ga0068859_100007768 3300005617 Bacteria 10890
42 Ga0068859_100060884 3300005617 Bacteria 3804
43 Ga0068859_100324220 3300005617 Bacteria 1634
44 Ga0068859_100324448 3300005617 Bacteria 1634
45 Ga0068866_10003868 3300005718 Bacteria 6142
46 Ga0068861_101563977 3300005719 Bacteria 649
47 Ga0068861_102327048 3300005719 Bacteria 538
48 Ga0068858_100000121 3300005842 Bacteria 80770
49 Ga0068862_100004861 3300005844 Bacteria 11312
50 Ga0081539_10000829 3300005985 Bacteria 59715
51 Ga0075363_100855459 3300006048 Bacteria 555
52 Ga0075362_10027040 3300006177 Bacteria 2454
53 Ga0075370_10221992 3300006353 Bacteria 1117
54 Ga0075428_100338237 3300006844 Bacteria 1616
55 Ga0075434_101521703 3300006871 Bacteria 678
56 Ga0075429_100247581 3300006880 Bacteria 1561
57 Ga0068865_100838038 3300006881 Bacteria 796
58 Ga0068865_101694118 3300006881 Bacteria 570
59 Ga0097620_100007768 3300006931 Bacteria 10890
60 Ga0097620_100060884 3300006931 Bacteria 3804
61 Ga0097620_100324207 3300006931 Bacteria 1634
62 Ga0097620_100324413 3300006931 Bacteria 1634
63 Ga0099795_10221564 3300007788 Bacteria 805
64 Ga0111539_10332401 3300009094 Bacteria 1769
65 Ga0111539_11483294 3300009094 Bacteria 787
66 Ga0111539_12562493 3300009094 Bacteria 591
67 Ga0105247_10000003 3300009101 Bacteria 694517
68 Ga0114129_10073641 3300009147 Bacteria 4758
69 Ga0114129_10119369 3300009147 Bacteria 3632
70 Ga0114129_10990129 3300009147 Bacteria 1059
71 Ga0105242_10340239 3300009176 Bacteria 1382
72 Ga0105242_12089619 3300009176 Bacteria 610
73 Ga0105249_11374818 3300009553 Bacteria 778
74 Ga0157378_10063297 3300013297 Bacteria 3305
75 Ga0157378_10168105 3300013297 Bacteria 2055
76 Ga0157378_10494898 3300013297 Bacteria 1220
77 Ga0163163_10029694 3300014325 Bacteria 5261
78 Ga0157379_10071231 3300014968 Bacteria 3110
79 Ga0163161_12068088 3300017792 Bacteria 506
80 Ga0207672_1000042 3300025223 Bacteria 16334
81 Ga0207642_10001831 3300025899 Bacteria 6568
82 Ga0207710_10000001 3300025900 Bacteria 1797433
83 Ga0207662_10487188 3300025918 Bacteria 847
84 Ga0207646_10270542 3300025922 Bacteria 1536
85 Ga0207694_11633348 3300025924 Bacteria 543
86 Ga0207650_10706576 3300025925 Bacteria 852
87 Ga0207659_10905928 3300025926 Bacteria 758
88 Ga0207659_11536907 3300025926 Bacteria 569
89 Ga0207706_10490677 3300025933 Bacteria 1061
90 Ga0207706_10598115 3300025933 Bacteria 947
91 Ga0207709_10191154 3300025935 Bacteria 1454
92 Ga0207670_10263964 3300025936 Bacteria 1336
93 Ga0207670_10662155 3300025936 Bacteria 862
94 Ga0207704_10434238 3300025938 Bacteria 1044
95 Ga0207691_10137346 3300025940 Bacteria 2156
96 Ga0207691_10175130 3300025940 Bacteria 1877
97 Ga0207651_10299988 3300025960 Bacteria 1336
98 Ga0207668_10059876 3300025972 Bacteria 2670
99 Ga0207668_11880355 3300025972 Bacteria 540
100 Ga0207658_10231313 3300025986 Bacteria 1561
101 Ga0207703_10000200 3300026035 Bacteria 69944
102 Ga0207676_12039529 3300026095 Bacteria 572
103 Ga0207674_11930207 3300026116 Bacteria 556
104 Ga0207675_101567288 3300026118 Bacteria 679
105 Ga0207675_102062670 3300026118 Bacteria 587
106 Ga0209983_1057409 3300027665 Bacteria 857
107 Ga0209974_10155805 3300027876 Bacteria 826
108 Ga0268266_10002760 3300028379 Bacteria 18356
109 Ga0268265_10040448 3300028380 Bacteria 3443
110 Ga0268265_10675442 3300028380 Bacteria 995
111 Ga0268264_10761628 3300028381 Bacteria 965
112 Ga0307516_10004805 3300031730 Bacteria 16463
113 Ga0307409_100489912 3300031995 Bacteria 1195
114 Ga0307416_101772043 3300032002 Bacteria 722
115 Ga0395905_0529474 3300037471 Bacteria 1079
116 Ga0451791_0542139 3300041451 Bacteria 1123
117 Ga0451800_0850481 3300041459 Bacteria 883
118 Ga0451837_1386598 3300041494 Bacteria 3138
119 Ga0439443_083198 3300042003 Bacteria 597
120 Ga0439462_0001926 3300042015 Bacteria 4732
121 Ga0450896_045645 3300042133 Bacteria 690
122 Ga0439446_0099655 3300042156 Bacteria 918
123 Ga0451576_1433280 3300045051 Bacteria 718
124 Ga0495639_0009055 3300046475 Bacteria 4270
125 Ga0495585_0634173 3300046492 Bacteria 501
126 Ga0495583_0000517 3300046506 Bacteria 55159
127 Ga0495606_0000600 3300046507 Bacteria 57013
128 Ga0495608_0119244 3300046511 Bacteria 1693
129 Ga0495630_0744541 3300046517 Bacteria 749
130 Ga0495663_0345524 3300046525 Bacteria 541
131 Ga0495634_0901125 3300046642 Bacteria 500
132 Ga0495649_0000702 3300046694 Bacteria 27319
133 Ga0495589_0055543 3300046794 Bacteria 1951
134 Ga0495683_0083785 3300047323 Bacteria 1552
135 Ga0495615_0019908 3300048090 Bacteria 1497
136 Ga0496116_0448533 3300048919 Bacteria 553
137 Ga0496117_0003560 3300048920 Bacteria 17974
138 Ga0496118_0000944 3300048921 Bacteria 45453
139 Ga0501034_0143736 3300049571 Bacteria 2364
140 Ga0501034_0720592 3300049571 Bacteria 895
141 Ga0501042_0151004 3300049578 Bacteria 1675
142 Ga0501075_0218482 3300049591 Bacteria 1454
143 Ga0501080_0197850 3300049742 Bacteria 1846
144 Ga0501080_0653798 3300049742 Bacteria 930
145 nmdc:mga05p37_667505_c1 3300050507 Bacteria 1161
146 nmdc:mga05p37_9246_c1 3300050507 Bacteria 11645
147 nmdc:mga09592_173986_c1 3300050508 Bacteria 1862
148 nmdc:mga08y16_1038889_c1 3300050511 Bacteria 797
149 nmdc:mga08y16_460183_c1 3300050511 Bacteria 1296
150 nmdc:mga0a205_1126695_c1 3300050515 Bacteria 632
151 Ga0500643_000233 3300053087 Bacteria 51480
152 Ga0500641_0003864 3300053096 Bacteria 5296
153 Ga0500593_136577 3300053117 Bacteria 971
154 Ga0500652_162261 3300053131 Bacteria 923
155 Ga0500604_0012451 3300053151 Bacteria 2297
156 Ga0500616_0090958 3300053153 Bacteria 1511
157 Ga0500645_000517 3300053730 Bacteria 25761
158 Ga0500645_053312 3300053730 Bacteria 1177
159 Ga0501084_0446220 3300054114 Bacteria 1094
160 Ga0500661_009590 3300055283 Bacteria 1770
161 Ga0590075_037980 3300059424 Bacteria 1228
162 Ga0590077_000141 3300059426 Bacteria 19753
163 Ga0530510_0760596 3300061734 Bacteria 739
164 2644493683 2643221688 Bacteria 5260751
165 2891376310 2891373044 Bacteria 5202277
166 Ga0070682_100083491
167 SwRhRL2b_contig_3050460
168 JGI24748J21848_1000005
169 JGI24034J26672_10000003
170 JGI24742J22300_10006582
171 JGI25406J46586_10045925
172 rootH1_10037172
173 Ga0065704_10097212
174 Ga0065707_10007749
175 Ga0065707_10168561
176 Ga0065707_10220760
177 Ga0070670_101005838
178 Ga0070677_10248650
179 Ga0070682_100009991
180 Ga0070689_100929346
181 Ga0070689_101049464
182 Ga0070691_10296594
183 Ga0070687_100623363
184 Ga0070692_10872761
185 Ga0070669_100525026
186 Ga0070675_102220119
187 Ga0070674_100998935
188 Ga0070673_100876237
189 Ga0070688_100346099
190 Ga0070667_100300960
191 Ga0070700_100163351
192 Ga0070694_100524940
193 Ga0070678_100039671
194 Ga0070685_10002185
195 Ga0070707_100192096
196 Ga0070698_100143867
197 Ga0070698_100163801
198 Ga0070699_100013313
199 Ga0070686_100383166
200 Ga0070695_100062952
201 Ga0070695_100143722
202 Ga0070665_100605091
203 Ga0070704_100216701
204 Ga0070704_101148676
205 Ga0070702_100933174
206 Ga0068859_100007768
207 Ga0068859_100060884
208 Ga0068859_100324220
209 Ga0068859_100324448
210 Ga0068866_10003868
211 Ga0068861_101563977
212 Ga0068861_102327048
213 Ga0068858_100000121
214 Ga0068862_100004861
215 Ga0081539_10000829
216 Ga0075363_100855459
217 Ga0075362_10027040
218 Ga0075370_10221992
219 Ga0075428_100338237
220 Ga0075434_101521703
221 Ga0075429_100247581
222 Ga0068865_100838038
223 Ga0068865_101694118
224 Ga0097620_100007768
225 Ga0097620_100060884
226 Ga0097620_100324207
227 Ga0097620_100324413
228 Ga0099795_10221564
229 Ga0111539_10332401
230 Ga0111539_11483294
231 Ga0111539_12562493
232 Ga0105247_10000003
233 Ga0114129_10073641
234 Ga0114129_10119369
235 Ga0114129_10990129
236 Ga0105242_10340239
237 Ga0105242_12089619
238 Ga0105249_11374818
239 Ga0157378_10063297
240 Ga0157378_10168105
241 Ga0157378_10494898
242 Ga0163163_10029694
243 Ga0157379_10071231
244 Ga0163161_12068088
245 Ga0207672_1000042
246 Ga0207642_10001831
247 Ga0207710_10000001
248 Ga0207662_10487188
249 Ga0207646_10270542
250 Ga0207694_11633348
251 Ga0207650_10706576
252 Ga0207659_10905928
253 Ga0207659_11536907
254 Ga0207706_10490677
255 Ga0207706_10598115
256 Ga0207709_10191154
257 Ga0207670_10263964
258 Ga0207670_10662155
259 Ga0207704_10434238
260 Ga0207691_10137346
261 Ga0207691_10175130
262 Ga0207651_10299988
263 Ga0207668_10059876
264 Ga0207668_11880355
265 Ga0207658_10231313
266 Ga0207703_10000200
267 Ga0207676_12039529
268 Ga0207674_11930207
269 Ga0207675_101567288
270 Ga0207675_102062670
271 Ga0209983_1057409
272 Ga0209974_10155805
273 Ga0268266_10002760
274 Ga0268265_10040448
275 Ga0268265_10675442
276 Ga0268264_10761628
277 Ga0307516_10004805
278 Ga0307409_100489912
279 Ga0307416_101772043
280 Ga0395905_0529474
281 Ga0451791_0542139
282 Ga0451800_0850481
283 Ga0451837_1386598
284 Ga0439443_083198
285 Ga0439462_0001926
286 Ga0450896_045645
287 Ga0439446_0099655
288 Ga0451576_1433280
289 Ga0495639_0009055
290 Ga0495585_0634173
291 Ga0495583_0000517
292 Ga0495606_0000600
293 Ga0495608_0119244
294 Ga0495630_0744541
295 Ga0495663_0345524
296 Ga0495634_0901125
297 Ga0495649_0000702
298 Ga0495589_0055543
299 Ga0495683_0083785
300 Ga0495615_0019908
301 Ga0496116_0448533
302 Ga0496117_0003560
303 Ga0496118_0000944
304 Ga0501034_0143736
305 Ga0501034_0720592
306 Ga0501042_0151004
307 Ga0501075_0218482
308 Ga0501080_0197850
309 Ga0501080_0653798
310 nmdc:mga05p37_667505_c1
311 nmdc:mga05p37_9246_c1
312 nmdc:mga09592_173986_c1
313 nmdc:mga08y16_1038889_c1
314 nmdc:mga08y16_460183_c1
315 nmdc:mga0a205_1126695_c1
316 Ga0500643_000233
317 Ga0500641_0003864
318 Ga0500593_136577
319 Ga0500652_162261
320 Ga0500604_0012451
321 Ga0500616_0090958
322 Ga0500645_000517
323 Ga0500645_053312
324 Ga0501084_0446220
325 Ga0500661_009590
326 Ga0590075_037980
327 Ga0590077_000141
328 Ga0530510_0760596
329 2644493683
330 2891376310

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

64

158

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4azs-assembly1.cif.gz_A high resolution (2.2 a) crystal structure of wbdd. 0.7416 74 90
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7207 28 137
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6435 28 137
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.6065 22 123
5ohy-assembly2.cif.gz_B a gh31 family sulfoquinovosidase in complex with aza-sugar inhibitor ifgsq 0.5861 57 88
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8113 23 130 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7671 23 130 3.90.1150.200
3s0wA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;OmpA-like domain 0.6686 70 88 3.30.1330.60
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6666 42 132 3.90.1150.30
2bsjB00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.5524 42 134 3.30.1460.10
ID Description Score Start End GO Terms
AF-A0A7Y5C6U8-F1-model_v4 DUF1801 domain-containing protein 0.9983 40 135
AF-A0A527XZ27-F1-model_v4 DUF1801 domain-containing protein 0.9968 48 138
AF-A0A135HS04-F1-model_v4 Histidine kinase 0.9963 17 138 GO:0016301
AF-A0A528AYQ3-F1-model_v4 DUF1801 domain-containing protein 0.9955 27 138
AF-A0A2W5UP62-F1-model_v4 Histidine kinase 0.9914 7 138 GO:0016301

Map