F245413
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 165 | 116 | 165 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100048244|Ga0070680_1000482443 |
| Length | 122 |
| Sequence | MNGVLLWCGVAVLGALGALARFLLDSAVASRIGGDFPFGTLAVNGSGALVLGLLVGLALEGDAYLLAGTATVGAYTTFSTWMLETHRLGEEGEPALLFANIVISAGIGLGAAVLGRAIGGAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 4 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 14 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 15 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 16 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 18 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 25 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 29 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 31 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 34 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 36 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 44 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 45 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 46 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 47 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 48 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 49 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 50 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 51 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 52 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 53 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 54 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 55 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 56 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 57 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 58 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 59 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 60 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 61 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 62 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 63 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 64 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 65 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 66 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 67 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 68 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 69 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 70 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 71 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 72 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 85 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 86 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 87 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 88 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 89 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 90 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 91 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 92 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 93 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 94 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 95 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 96 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 97 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 98 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 99 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 101 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 107 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 111 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 112 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 113 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 115 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.61 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.61 |
| Nodule | 0 |
| Rhizoplane | 17.58 |
| Rhizosphere | 81.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100350840 | 3300005329 | Bacteria | 1405 |
| 2 | Ga0070680_100048244 | 3300005336 | Bacteria | 3470 |
| 3 | Ga0068868_100000082 | 3300005338 | Bacteria | 57070 |
| 4 | Ga0070675_100499328 | 3300005354 | Bacteria | 1096 |
| 5 | Ga0070714_100018641 | 3300005435 | Bacteria | 5642 |
| 6 | Ga0070714_100786079 | 3300005435 | Bacteria | 921 |
| 7 | Ga0070714_101680635 | 3300005435 | Bacteria | 620 |
| 8 | Ga0070662_100000004 | 3300005457 | Bacteria | 195534 |
| 9 | Ga0070681_10010572 | 3300005458 | Bacteria | 9116 |
| 10 | Ga0070699_101412689 | 3300005518 | Bacteria | 638 |
| 11 | Ga0070679_100002508 | 3300005530 | Bacteria | 16634 |
| 12 | Ga0070684_102074253 | 3300005535 | Bacteria | 537 |
| 13 | Ga0070697_100320742 | 3300005536 | Bacteria | 1334 |
| 14 | Ga0070693_100003484 | 3300005547 | Bacteria | 7346 |
| 15 | Ga0068855_100130457 | 3300005563 | Bacteria | 2871 |
| 16 | Ga0068856_100184217 | 3300005614 | Bacteria | 2101 |
| 17 | Ga0068856_100896677 | 3300005614 | Bacteria | 906 |
| 18 | Ga0068859_103087439 | 3300005617 | Bacteria | 508 |
| 19 | Ga0070717_10078815 | 3300006028 | Bacteria | 2761 |
| 20 | Ga0070717_10859553 | 3300006028 | Bacteria | 825 |
| 21 | Ga0075429_100941130 | 3300006880 | Bacteria | 756 |
| 22 | Ga0097620_103088484 | 3300006931 | Bacteria | 508 |
| 23 | Ga0105240_10006181 | 3300009093 | Bacteria | 17644 |
| 24 | Ga0111539_10739429 | 3300009094 | Bacteria | 1145 |
| 25 | Ga0114129_10692263 | 3300009147 | Bacteria | 1311 |
| 26 | Ga0105241_10413757 | 3300009174 | Bacteria | 1185 |
| 27 | Ga0105249_10214881 | 3300009553 | Bacteria | 1889 |
| 28 | Ga0157369_11912248 | 3300013105 | Bacteria | 602 |
| 29 | Ga0157372_10299761 | 3300013307 | Bacteria | 1870 |
| 30 | Ga0157375_10828452 | 3300013308 | Bacteria | 1073 |
| 31 | Ga0163163_10198711 | 3300014325 | Bacteria | 2053 |
| 32 | Ga0206356_11208173 | 3300020070 | Bacteria | 570 |
| 33 | Ga0207707_10009788 | 3300025912 | Bacteria | 8313 |
| 34 | Ga0207707_10932552 | 3300025912 | Bacteria | 716 |
| 35 | Ga0207695_10011242 | 3300025913 | Bacteria | 10854 |
| 36 | Ga0207693_10321776 | 3300025915 | Bacteria | 1211 |
| 37 | Ga0207660_10013282 | 3300025917 | Bacteria | 5396 |
| 38 | Ga0207657_10642501 | 3300025919 | Bacteria | 826 |
| 39 | Ga0207657_10752139 | 3300025919 | Bacteria | 755 |
| 40 | Ga0207652_10000687 | 3300025921 | Bacteria | 32979 |
| 41 | Ga0207652_10220767 | 3300025921 | Bacteria | 1708 |
| 42 | Ga0207652_10561049 | 3300025921 | Bacteria | 1026 |
| 43 | Ga0207664_10002561 | 3300025929 | Bacteria | 12017 |
| 44 | Ga0207664_10009560 | 3300025929 | Bacteria | 6808 |
| 45 | Ga0207664_10267768 | 3300025929 | Bacteria | 1496 |
| 46 | Ga0207690_10744437 | 3300025932 | Bacteria | 808 |
| 47 | Ga0207706_10000012 | 3300025933 | Bacteria | 195475 |
| 48 | Ga0207706_11252308 | 3300025933 | Unclassified | 615 |
| 49 | Ga0207669_10273182 | 3300025937 | Bacteria | 1271 |
| 50 | Ga0207661_10644361 | 3300025944 | Bacteria | 974 |
| 51 | Ga0207677_10000519 | 3300026023 | Bacteria | 24757 |
| 52 | Ga0207677_10109005 | 3300026023 | Bacteria | 2058 |
| 53 | Ga0207702_10088349 | 3300026078 | Bacteria | 2707 |
| 54 | Ga0207641_10950776 | 3300026088 | Bacteria | 855 |
| 55 | Ga0265327_10144543 | 3300031251 | Bacteria | 1109 |
| 56 | Ga0307408_100060355 | 3300031548 | Bacteria | 2764 |
| 57 | Ga0307405_10251027 | 3300031731 | Bacteria | 1316 |
| 58 | Ga0307413_10058105 | 3300031824 | Bacteria | 2369 |
| 59 | Ga0307413_10071190 | 3300031824 | Bacteria | 2190 |
| 60 | Ga0307413_10173123 | 3300031824 | Bacteria | 1530 |
| 61 | Ga0307410_10166318 | 3300031852 | Bacteria | 1657 |
| 62 | Ga0307406_10101346 | 3300031901 | Bacteria | 1962 |
| 63 | Ga0307406_10217711 | 3300031901 | Bacteria | 1417 |
| 64 | Ga0307406_10596520 | 3300031901 | Bacteria | 910 |
| 65 | Ga0307406_10605326 | 3300031901 | Bacteria | 904 |
| 66 | Ga0307406_10625908 | 3300031901 | Bacteria | 890 |
| 67 | Ga0307407_10013942 | 3300031903 | Bacteria | 3918 |
| 68 | Ga0307407_10176993 | 3300031903 | Bacteria | 1410 |
| 69 | Ga0307407_10970371 | 3300031903 | Bacteria | 655 |
| 70 | Ga0307412_10070069 | 3300031911 | Bacteria | 2389 |
| 71 | Ga0307412_10576133 | 3300031911 | Bacteria | 949 |
| 72 | Ga0307412_11185565 | 3300031911 | Bacteria | 683 |
| 73 | Ga0307409_100013925 | 3300031995 | Bacteria | 5203 |
| 74 | Ga0307409_100054779 | 3300031995 | Bacteria | 3074 |
| 75 | Ga0307416_100001133 | 3300032002 | Bacteria | 14326 |
| 76 | Ga0307416_100075520 | 3300032002 | Bacteria | 2820 |
| 77 | Ga0307416_100141317 | 3300032002 | Bacteria | 2188 |
| 78 | Ga0307414_11690824 | 3300032004 | Bacteria | 590 |
| 79 | Ga0307411_10106345 | 3300032005 | Bacteria | 1997 |
| 80 | Ga0307415_100000788 | 3300032126 | Bacteria | 14368 |
| 81 | Ga0307415_100038013 | 3300032126 | Bacteria | 3168 |
| 82 | Ga0307415_100046013 | 3300032126 | Bacteria | 2929 |
| 83 | Ga0373935_0900560 | 3300035692 | Bacteria | 655 |
| 84 | Ga0373947_0592811 | 3300035725 | Bacteria | 755 |
| 85 | Ga0395900_0660912 | 3300037418 | Bacteria | 981 |
| 86 | Ga0395905_1465955 | 3300037471 | Bacteria | 587 |
| 87 | Ga0395901_0039999 | 3300038443 | Bacteria | 4854 |
| 88 | Ga0395901_0129335 | 3300038443 | Bacteria | 2654 |
| 89 | Ga0395901_0907927 | 3300038443 | Bacteria | 862 |
| 90 | Ga0395901_1194911 | 3300038443 | Bacteria | 727 |
| 91 | Ga0439443_074833 | 3300042003 | Bacteria | 623 |
| 92 | Ga0439450_049800 | 3300042008 | Bacteria | 993 |
| 93 | Ga0466966_0099092 | 3300044684 | Bacteria | 1804 |
| 94 | Ga0466966_0114807 | 3300044684 | Bacteria | 1658 |
| 95 | Ga0466961_0049156 | 3300044693 | Bacteria | 2696 |
| 96 | Ga0466971_0375834 | 3300044719 | Bacteria | 690 |
| 97 | Ga0466968_0051659 | 3300044735 | Bacteria | 1757 |
| 98 | Ga0466957_0040090 | 3300044842 | Bacteria | 2828 |
| 99 | Ga0466960_0022468 | 3300044901 | Unclassified | 2821 |
| 100 | Ga0466960_0069225 | 3300044901 | Bacteria | 1753 |
| 101 | Ga0466960_0105079 | 3300044901 | Bacteria | 1459 |
| 102 | Ga0466959_0073927 | 3300045049 | Bacteria | 2465 |
| 103 | Ga0466958_0023787 | 3300045836 | Bacteria | 3600 |
| 104 | Ga0466967_0305335 | 3300045976 | Bacteria | 1532 |
| 105 | Ga0466967_1632513 | 3300045976 | Bacteria | 642 |
| 106 | Ga0495603_0134260 | 3300046455 | Bacteria | 1441 |
| 107 | Ga0495641_0042770 | 3300046461 | Bacteria | 2098 |
| 108 | Ga0495608_0795744 | 3300046511 | Bacteria | 558 |
| 109 | Ga0495586_0669408 | 3300046535 | Unclassified | 599 |
| 110 | Ga0495598_0339830 | 3300046537 | Bacteria | 576 |
| 111 | Ga0495658_0671944 | 3300046683 | Bacteria | 663 |
| 112 | Ga0495600_0160163 | 3300046809 | Bacteria | 1455 |
| 113 | Ga0495581_0525904 | 3300047315 | Bacteria | 687 |
| 114 | Ga0495604_0000063 | 3300047317 | Bacteria | 92821 |
| 115 | Ga0495674_0658755 | 3300047319 | Unclassified | 825 |
| 116 | Ga0495684_0237720 | 3300047471 | Bacteria | 1330 |
| 117 | Ga0495602_0135530 | 3300048088 | Bacteria | 1957 |
| 118 | Ga0496100_0564158 | 3300048903 | Bacteria | 882 |
| 119 | Ga0496101_1495445 | 3300048904 | Bacteria | 526 |
| 120 | Ga0496102_0000002 | 3300048905 | Bacteria | 814588 |
| 121 | Ga0496102_0044295 | 3300048905 | Bacteria | 4038 |
| 122 | Ga0496103_0000047 | 3300048906 | Bacteria | 161130 |
| 123 | Ga0496103_0313004 | 3300048906 | Bacteria | 1010 |
| 124 | Ga0496104_0000037 | 3300048907 | Bacteria | 178518 |
| 125 | Ga0496104_0097422 | 3300048907 | Bacteria | 2815 |
| 126 | Ga0496104_0281278 | 3300048907 | Bacteria | 1577 |
| 127 | Ga0496105_0082231 | 3300048908 | Bacteria | 2660 |
| 128 | Ga0496105_0502033 | 3300048908 | Bacteria | 952 |
| 129 | Ga0496105_1320730 | 3300048908 | Bacteria | 526 |
| 130 | Ga0496106_0095331 | 3300048909 | Bacteria | 2301 |
| 131 | Ga0496107_0084123 | 3300048910 | Bacteria | 2321 |
| 132 | Ga0496108_0000650 | 3300048911 | Bacteria | 27089 |
| 133 | Ga0496108_0350642 | 3300048911 | Bacteria | 1288 |
| 134 | Ga0496109_0002586 | 3300048912 | Bacteria | 15159 |
| 135 | Ga0496109_0034409 | 3300048912 | Bacteria | 4562 |
| 136 | Ga0496110_0000360 | 3300048913 | Bacteria | 30495 |
| 137 | Ga0496110_0000684 | 3300048913 | Bacteria | 23345 |
| 138 | Ga0496111_0000059 | 3300048914 | Bacteria | 44577 |
| 139 | Ga0496111_0020046 | 3300048914 | Bacteria | 4651 |
| 140 | Ga0496111_0783854 | 3300048914 | Bacteria | 690 |
| 141 | Ga0496112_0000389 | 3300048915 | Bacteria | 28795 |
| 142 | Ga0496112_0063722 | 3300048915 | Bacteria | 3637 |
| 143 | Ga0496112_0341111 | 3300048915 | Bacteria | 1442 |
| 144 | Ga0496113_0147108 | 3300048916 | Bacteria | 1857 |
| 145 | Ga0496113_0338086 | 3300048916 | Bacteria | 1207 |
| 146 | Ga0496114_0691702 | 3300048917 | Bacteria | 895 |
| 147 | Ga0501047_0335489 | 3300049581 | Unclassified | 1350 |
| 148 | Ga0501048_1346550 | 3300049582 | Bacteria | 513 |
| 149 | Ga0501067_0312814 | 3300049583 | Bacteria | 875 |
| 150 | Ga0501069_0039416 | 3300049585 | Bacteria | 2610 |
| 151 | Ga0501070_0046262 | 3300049586 | Bacteria | 3618 |
| 152 | Ga0501074_0005269 | 3300049590 | Bacteria | 9309 |
| 153 | Ga0501074_0812833 | 3300049590 | Bacteria | 659 |
| 154 | Ga0501079_0109437 | 3300049741 | Bacteria | 2146 |
| 155 | Ga0501080_0046483 | 3300049742 | Bacteria | 4041 |
| 156 | Ga0501083_0078873 | 3300049744 | Bacteria | 2184 |
| 157 | Ga0501035_0654695 | 3300049822 | Unclassified | 851 |
| 158 | Ga0501044_0125281 | 3300049823 | Bacteria | 2567 |
| 159 | nmdc:mga05p37_591162_c1 | 3300050507 | Bacteria | 1255 |
| 160 | nmdc:mga08y16_214238_c1 | 3300050511 | Bacteria | 1994 |
| 161 | nmdc:mga0rr50_1566035_c1 | 3300050513 | Bacteria | 556 |
| 162 | Ga0495655_0000004 | 3300053083 | Bacteria | 293683 |
| 163 | Ga0500628_000037 | 3300053129 | Bacteria | 50133 |
| 164 | Ga0501082_0377453 | 3300060353 | Bacteria | 1237 |
| 165 | Ga0466962_0045613 | 3300061719 | Unclassified | 2095 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042008 | Ga0439450_049800 | Ga0439450_049800_632_907 | 91 |
| 2 | 3300047471 | Ga0495684_0237720 | Ga0495684_0237720_565_960 | 93 |
| 3 | 3300006028 | Ga0070717_10078815 | Ga0070717_100788152 | 94 |
| 4 | 3300047319 | Ga0495674_0658755 | Ga0495674_0658755_302_670 | 97 |
| 5 | 3300050513 | nmdc:mga0rr50_1566035_c1 | nmdc:mga0rr50_1566035_c1_11_373 | 99 |
| 6 | 3300013105 | Ga0157369_11912248 | Ga0157369_119122482 | 101 |
| 7 | 3300005518 | Ga0070699_101412689 | Ga0070699_1014126891 | 104 |
| 8 | 3300031548 | Ga0307408_100060355 | Ga0307408_1000603552 | 104 |
| 9 | 3300031731 | Ga0307405_10251027 | Ga0307405_102510272 | 104 |
| 10 | 3300031824 | Ga0307413_10071190 | Ga0307413_100711902 | 104 |
| 11 | 3300031852 | Ga0307410_10166318 | Ga0307410_101663182 | 104 |
| 12 | 3300031901 | Ga0307406_10625908 | Ga0307406_106259082 | 104 |
| 13 | 3300031903 | Ga0307407_10013942 | Ga0307407_100139424 | 104 |
| 14 | 3300031911 | Ga0307412_10576133 | Ga0307412_105761332 | 104 |
| 15 | 3300031995 | Ga0307409_100054779 | Ga0307409_1000547792 | 104 |
| 16 | 3300032002 | Ga0307416_100075520 | Ga0307416_1000755203 | 104 |
| 17 | 3300032126 | Ga0307415_100046013 | Ga0307415_1000460133 | 104 |
| 18 | 3300046535 | Ga0495586_0669408 | Ga0495586_0669408_62_427 | 106 |
| 19 | 3300037418 | Ga0395900_0660912 | Ga0395900_0660912_336_701 | 107 |
| 20 | 3300037471 | Ga0395905_1465955 | Ga0395905_1465955_207_572 | 107 |
| 21 | 3300038443 | Ga0395901_0039999 | Ga0395901_0039999_2118_2483 | 107 |
| 22 | 3300042003 | Ga0439443_074833 | Ga0439443_074833_104_469 | 107 |
| 23 | 3300046537 | Ga0495598_0339830 | Ga0495598_0339830_125_490 | 107 |
| 24 | 3300048088 | Ga0495602_0135530 | Ga0495602_0135530_1517_1885 | 107 |
| 25 | 3300048907 | Ga0496104_0000037 | Ga0496104_0000037_121954_122319 | 107 |
| 26 | 3300048908 | Ga0496105_0502033 | Ga0496105_0502033_570_935 | 107 |
| 27 | 3300048913 | Ga0496110_0000360 | Ga0496110_0000360_12364_12729 | 107 |
| 28 | 3300048914 | Ga0496111_0000059 | Ga0496111_0000059_31407_31772 | 107 |
| 29 | 3300005435 | Ga0070714_101680635 | Ga0070714_1016806351 | 108 |
| 30 | 3300005535 | Ga0070684_102074253 | Ga0070684_1020742531 | 108 |
| 31 | 3300005617 | Ga0068859_103087439 | Ga0068859_1030874391 | 108 |
| 32 | 3300006931 | Ga0097620_103088484 | Ga0097620_1030884841 | 108 |
| 33 | 3300020070 | Ga0206356_11208173 | Ga0206356_112081732 | 108 |
| 34 | 3300025912 | Ga0207707_10932552 | Ga0207707_109325522 | 108 |
| 35 | 3300025919 | Ga0207657_10752139 | Ga0207657_107521392 | 108 |
| 36 | 3300025921 | Ga0207652_10561049 | Ga0207652_105610492 | 108 |
| 37 | 3300031901 | Ga0307406_10101346 | Ga0307406_101013462 | 108 |
| 38 | 3300031903 | Ga0307407_10970371 | Ga0307407_109703712 | 108 |
| 39 | 3300045976 | Ga0466967_1632513 | Ga0466967_1632513_11_337 | 108 |
| 40 | 3300048915 | Ga0496112_0341111 | Ga0496112_0341111_1036_1362 | 108 |
| 41 | 3300048915 | Ga0496112_0000389 | Ga0496112_0000389_5830_6198 | 109 |
| 42 | 3300014325 | Ga0163163_10198711 | Ga0163163_101987112 | 111 |
| 43 | 3300025932 | Ga0207690_10744437 | Ga0207690_107444372 | 112 |
| 44 | 3300031824 | Ga0307413_10173123 | Ga0307413_101731232 | 112 |
| 45 | 3300031901 | Ga0307406_10605326 | Ga0307406_106053262 | 112 |
| 46 | 3300031911 | Ga0307412_10070069 | Ga0307412_100700693 | 112 |
| 47 | 3300032002 | Ga0307416_100141317 | Ga0307416_1001413172 | 112 |
| 48 | 3300032126 | Ga0307415_100038013 | Ga0307415_1000380132 | 112 |
| 49 | 3300038443 | Ga0395901_0907927 | Ga0395901_0907927_64_408 | 114 |
| 50 | 3300005435 | Ga0070714_100018641 | Ga0070714_1000186415 | 115 |
| 51 | 3300025929 | Ga0207664_10009560 | Ga0207664_100095608 | 115 |
| 52 | 3300044693 | Ga0466961_0049156 | Ga0466961_0049156_1473_1820 | 115 |
| 53 | 3300044719 | Ga0466971_0375834 | Ga0466971_0375834_43_390 | 115 |
| 54 | 3300044735 | Ga0466968_0051659 | Ga0466968_0051659_87_434 | 115 |
| 55 | 3300044842 | Ga0466957_0040090 | Ga0466957_0040090_192_539 | 115 |
| 56 | 3300045049 | Ga0466959_0073927 | Ga0466959_0073927_649_996 | 115 |
| 57 | 3300045836 | Ga0466958_0023787 | Ga0466958_0023787_499_846 | 115 |
| 58 | 3300047317 | Ga0495604_0000063 | Ga0495604_0000063_79933_80298 | 115 |
| 59 | 3300061719 | Ga0466962_0045613 | Ga0466962_0045613_1303_1650 | 115 |
| 60 | 3300009553 | Ga0105249_10214881 | Ga0105249_102148813 | 116 |
| 61 | 3300025921 | Ga0207652_10220767 | Ga0207652_102207673 | 116 |
| 62 | 3300025933 | Ga0207706_11252308 | Ga0207706_112523081 | 116 |
| 63 | 3300025937 | Ga0207669_10273182 | Ga0207669_102731822 | 116 |
| 64 | 3300013308 | Ga0157375_10828452 | Ga0157375_108284522 | 117 |
| 65 | 3300025944 | Ga0207661_10644361 | Ga0207661_106443612 | 118 |
| 66 | 3300044684 | Ga0466966_0114807 | Ga0466966_0114807_715_1080 | 118 |
| 67 | 3300045976 | Ga0466967_0305335 | Ga0466967_0305335_546_902 | 118 |
| 68 | 3300044901 | Ga0466960_0069225 | Ga0466960_0069225_925_1287 | 119 |
| 69 | 3300031901 | Ga0307406_10217711 | Ga0307406_102177112 | 120 |
| 70 | 3300031911 | Ga0307412_11185565 | Ga0307412_111855652 | 120 |
| 71 | 3300031995 | Ga0307409_100013925 | Ga0307409_1000139254 | 120 |
| 72 | 3300032002 | Ga0307416_100001133 | Ga0307416_1000011333 | 120 |
| 73 | 3300032005 | Ga0307411_10106345 | Ga0307411_101063453 | 120 |
| 74 | 3300032126 | Ga0307415_100000788 | Ga0307415_1000007883 | 120 |
| 75 | 3300005329 | Ga0070683_100350840 | Ga0070683_1003508403 | 121 |
| 76 | 3300005336 | Ga0070680_100048244 | Ga0070680_1000482443 | 121 |
| 77 | 3300005338 | Ga0068868_100000082 | Ga0068868_1000000827 | 121 |
| 78 | 3300005354 | Ga0070675_100499328 | Ga0070675_1004993282 | 121 |
| 79 | 3300005435 | Ga0070714_100786079 | Ga0070714_1007860792 | 121 |
| 80 | 3300005457 | Ga0070662_100000004 | Ga0070662_10000000478 | 121 |
| 81 | 3300005458 | Ga0070681_10010572 | Ga0070681_1001057211 | 121 |
| 82 | 3300005530 | Ga0070679_100002508 | Ga0070679_10000250817 | 121 |
| 83 | 3300005536 | Ga0070697_100320742 | Ga0070697_1003207422 | 121 |
| 84 | 3300005547 | Ga0070693_100003484 | Ga0070693_1000034846 | 121 |
| 85 | 3300005563 | Ga0068855_100130457 | Ga0068855_1001304572 | 121 |
| 86 | 3300005614 | Ga0068856_100184217 | Ga0068856_1001842173 | 121 |
| 87 | 3300005614 | Ga0068856_100896677 | Ga0068856_1008966772 | 121 |
| 88 | 3300006028 | Ga0070717_10859553 | Ga0070717_108595532 | 121 |
| 89 | 3300006880 | Ga0075429_100941130 | Ga0075429_1009411301 | 121 |
| 90 | 3300009093 | Ga0105240_10006181 | Ga0105240_100061818 | 121 |
| 91 | 3300009094 | Ga0111539_10739429 | Ga0111539_107394292 | 121 |
| 92 | 3300009147 | Ga0114129_10692263 | Ga0114129_106922632 | 121 |
| 93 | 3300009174 | Ga0105241_10413757 | Ga0105241_104137572 | 121 |
| 94 | 3300013307 | Ga0157372_10299761 | Ga0157372_102997613 | 121 |
| 95 | 3300025912 | Ga0207707_10009788 | Ga0207707_100097882 | 121 |
| 96 | 3300025913 | Ga0207695_10011242 | Ga0207695_100112428 | 121 |
| 97 | 3300025915 | Ga0207693_10321776 | Ga0207693_103217762 | 121 |
| 98 | 3300025917 | Ga0207660_10013282 | Ga0207660_100132822 | 121 |
| 99 | 3300025919 | Ga0207657_10642501 | Ga0207657_106425012 | 121 |
| 100 | 3300025921 | Ga0207652_10000687 | Ga0207652_1000068722 | 121 |
| 101 | 3300025929 | Ga0207664_10002561 | Ga0207664_100025612 | 121 |
| 102 | 3300025929 | Ga0207664_10267768 | Ga0207664_102677683 | 121 |
| 103 | 3300025933 | Ga0207706_10000012 | Ga0207706_10000012140 | 121 |
| 104 | 3300026023 | Ga0207677_10000519 | Ga0207677_1000051925 | 121 |
| 105 | 3300026023 | Ga0207677_10109005 | Ga0207677_101090053 | 121 |
| 106 | 3300026078 | Ga0207702_10088349 | Ga0207702_100883493 | 121 |
| 107 | 3300026088 | Ga0207641_10950776 | Ga0207641_109507762 | 121 |
| 108 | 3300031251 | Ga0265327_10144543 | Ga0265327_101445432 | 121 |
| 109 | 3300031824 | Ga0307413_10058105 | Ga0307413_100581053 | 121 |
| 110 | 3300031901 | Ga0307406_10596520 | Ga0307406_105965201 | 121 |
| 111 | 3300031903 | Ga0307407_10176993 | Ga0307407_101769933 | 121 |
| 112 | 3300032004 | Ga0307414_11690824 | Ga0307414_116908242 | 121 |
| 113 | 3300035692 | Ga0373935_0900560 | Ga0373935_0900560_255_620 | 121 |
| 114 | 3300035725 | Ga0373947_0592811 | Ga0373947_0592811_17_382 | 121 |
| 115 | 3300038443 | Ga0395901_0129335 | Ga0395901_0129335_1415_1780 | 121 |
| 116 | 3300038443 | Ga0395901_1194911 | Ga0395901_1194911_303_668 | 121 |
| 117 | 3300044684 | Ga0466966_0099092 | Ga0466966_0099092_608_973 | 121 |
| 118 | 3300044901 | Ga0466960_0022468 | Ga0466960_0022468_458_826 | 121 |
| 119 | 3300044901 | Ga0466960_0105079 | Ga0466960_0105079_1028_1396 | 121 |
| 120 | 3300046455 | Ga0495603_0134260 | Ga0495603_0134260_214_579 | 121 |
| 121 | 3300046461 | Ga0495641_0042770 | Ga0495641_0042770_1121_1486 | 121 |
| 122 | 3300046511 | Ga0495608_0795744 | Ga0495608_0795744_18_383 | 121 |
| 123 | 3300046683 | Ga0495658_0671944 | Ga0495658_0671944_183_548 | 121 |
| 124 | 3300046809 | Ga0495600_0160163 | Ga0495600_0160163_390_755 | 121 |
| 125 | 3300047315 | Ga0495581_0525904 | Ga0495581_0525904_283_648 | 121 |
| 126 | 3300048903 | Ga0496100_0564158 | Ga0496100_0564158_262_627 | 121 |
| 127 | 3300048904 | Ga0496101_1495445 | Ga0496101_1495445_28_393 | 121 |
| 128 | 3300048905 | Ga0496102_0000002 | Ga0496102_0000002_34163_34528 | 121 |
| 129 | 3300048905 | Ga0496102_0044295 | Ga0496102_0044295_333_698 | 121 |
| 130 | 3300048906 | Ga0496103_0000047 | Ga0496103_0000047_115474_115839 | 121 |
| 131 | 3300048906 | Ga0496103_0313004 | Ga0496103_0313004_424_789 | 121 |
| 132 | 3300048907 | Ga0496104_0097422 | Ga0496104_0097422_1652_2017 | 121 |
| 133 | 3300048907 | Ga0496104_0281278 | Ga0496104_0281278_1107_1472 | 121 |
| 134 | 3300048908 | Ga0496105_0082231 | Ga0496105_0082231_701_1066 | 121 |
| 135 | 3300048908 | Ga0496105_1320730 | Ga0496105_1320730_112_477 | 121 |
| 136 | 3300048909 | Ga0496106_0095331 | Ga0496106_0095331_1421_1786 | 121 |
| 137 | 3300048910 | Ga0496107_0084123 | Ga0496107_0084123_118_483 | 121 |
| 138 | 3300048911 | Ga0496108_0000650 | Ga0496108_0000650_19426_19791 | 121 |
| 139 | 3300048911 | Ga0496108_0350642 | Ga0496108_0350642_402_767 | 121 |
| 140 | 3300048912 | Ga0496109_0002586 | Ga0496109_0002586_5638_6003 | 121 |
| 141 | 3300048912 | Ga0496109_0034409 | Ga0496109_0034409_642_1007 | 121 |
| 142 | 3300048913 | Ga0496110_0000684 | Ga0496110_0000684_21217_21582 | 121 |
| 143 | 3300048914 | Ga0496111_0020046 | Ga0496111_0020046_1687_2052 | 121 |
| 144 | 3300048914 | Ga0496111_0783854 | Ga0496111_0783854_109_474 | 121 |
| 145 | 3300048915 | Ga0496112_0063722 | Ga0496112_0063722_3111_3476 | 121 |
| 146 | 3300048916 | Ga0496113_0147108 | Ga0496113_0147108_267_632 | 121 |
| 147 | 3300048916 | Ga0496113_0338086 | Ga0496113_0338086_81_446 | 121 |
| 148 | 3300048917 | Ga0496114_0691702 | Ga0496114_0691702_469_834 | 121 |
| 149 | 3300049581 | Ga0501047_0335489 | Ga0501047_0335489_122_487 | 121 |
| 150 | 3300049582 | Ga0501048_1346550 | Ga0501048_1346550_127_492 | 121 |
| 151 | 3300049583 | Ga0501067_0312814 | Ga0501067_0312814_290_655 | 121 |
| 152 | 3300049585 | Ga0501069_0039416 | Ga0501069_0039416_340_705 | 121 |
| 153 | 3300049586 | Ga0501070_0046262 | Ga0501070_0046262_2378_2743 | 121 |
| 154 | 3300049590 | Ga0501074_0005269 | Ga0501074_0005269_5538_5903 | 121 |
| 155 | 3300049590 | Ga0501074_0812833 | Ga0501074_0812833_198_563 | 121 |
| 156 | 3300049741 | Ga0501079_0109437 | Ga0501079_0109437_97_462 | 121 |
| 157 | 3300049742 | Ga0501080_0046483 | Ga0501080_0046483_2684_3049 | 121 |
| 158 | 3300049744 | Ga0501083_0078873 | Ga0501083_0078873_247_612 | 121 |
| 159 | 3300049822 | Ga0501035_0654695 | Ga0501035_0654695_40_405 | 121 |
| 160 | 3300049823 | Ga0501044_0125281 | Ga0501044_0125281_1637_2002 | 121 |
| 161 | 3300050507 | nmdc:mga05p37_591162_c1 | nmdc:mga05p37_591162_c1_382_747 | 121 |
| 162 | 3300050511 | nmdc:mga08y16_214238_c1 | nmdc:mga08y16_214238_c1_698_1063 | 121 |
| 163 | 3300053083 | Ga0495655_0000004 | Ga0495655_0000004_62593_62958 | 121 |
| 164 | 3300053129 | Ga0500628_000037 | Ga0500628_000037_28637_29002 | 121 |
| 165 | 3300060353 | Ga0501082_0377453 | Ga0501082_0377453_803_1168 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bx5-assembly1.cif.gz_A | the crystal structure of fluoride channel fluc ec2 with monobody s12 | 0.8861 | 2 | 116 |
| 7kkb-assembly1.cif.gz_B | fluoride channel fluc-ec2 mutant s81c with bromide | 0.8786 | 2 | 116 |
| 6bqo-assembly1.cif.gz_A | structure of a dual topology fluoride channel with monobody s8 | 0.8726 | 2 | 118 |
| 7kk8-assembly1.cif.gz_B | fluoride channel fluc-ec2 mutant s81t with bromide | 0.8622 | 2 | 116 |
| 5a40-assembly2.cif.gz_C | crystal structure of a dual topology fluoride ion channel. | 0.8608 | 2 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.97 | 8 | 114 | 1.10.287.70 |
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9442 | 8 | 114 | 1.10.287.70 |
| af_Q2FXE5_5_115_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9061 | 13 | 114 | 1.10.287.70 |
| af_Q58918_7_116_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8953 | 9 | 114 | 1.10.287.70 |
| af_P37002_6_119_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8885 | 8 | 115 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B8TZE5-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9795 | 2 | 118 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A1Q3NIL5-F1-model_v4 | deleted | 0.9767 | 1 | 116 |
|
| AF-A0A1E3RS30-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9749 | 1 | 121 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A6J5Z6G1-F1-model_v4 | Unannotated protein | 0.9701 | 1 | 121 |
GO:0005886
GO:1903425 |
| AF-A0A552ZDL6-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9699 | 4 | 121 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar