F245413

General Info

Members Datasets Scaffolds Average Seq Length
165 116 165 116

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100048244|Ga0070680_1000482443
Length 122
Sequence MNGVLLWCGVAVLGALGALARFLLDSAVASRIGGDFPFGTLAVNGSGALVLGLLVGLALEGDAYLLAGTATVGAYTTFSTWMLETHRLGEEGEPALLFANIVISAGIGLGAAVLGRAIGGAL

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
50 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
56 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
61 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
62 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
69 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
75 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
76 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
79 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
85 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
89 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
102 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
114 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 17.58
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100350840 3300005329 Bacteria 1405
2 Ga0070680_100048244 3300005336 Bacteria 3470
3 Ga0068868_100000082 3300005338 Bacteria 57070
4 Ga0070675_100499328 3300005354 Bacteria 1096
5 Ga0070714_100018641 3300005435 Bacteria 5642
6 Ga0070714_100786079 3300005435 Bacteria 921
7 Ga0070714_101680635 3300005435 Bacteria 620
8 Ga0070662_100000004 3300005457 Bacteria 195534
9 Ga0070681_10010572 3300005458 Bacteria 9116
10 Ga0070699_101412689 3300005518 Bacteria 638
11 Ga0070679_100002508 3300005530 Bacteria 16634
12 Ga0070684_102074253 3300005535 Bacteria 537
13 Ga0070697_100320742 3300005536 Bacteria 1334
14 Ga0070693_100003484 3300005547 Bacteria 7346
15 Ga0068855_100130457 3300005563 Bacteria 2871
16 Ga0068856_100184217 3300005614 Bacteria 2101
17 Ga0068856_100896677 3300005614 Bacteria 906
18 Ga0068859_103087439 3300005617 Bacteria 508
19 Ga0070717_10078815 3300006028 Bacteria 2761
20 Ga0070717_10859553 3300006028 Bacteria 825
21 Ga0075429_100941130 3300006880 Bacteria 756
22 Ga0097620_103088484 3300006931 Bacteria 508
23 Ga0105240_10006181 3300009093 Bacteria 17644
24 Ga0111539_10739429 3300009094 Bacteria 1145
25 Ga0114129_10692263 3300009147 Bacteria 1311
26 Ga0105241_10413757 3300009174 Bacteria 1185
27 Ga0105249_10214881 3300009553 Bacteria 1889
28 Ga0157369_11912248 3300013105 Bacteria 602
29 Ga0157372_10299761 3300013307 Bacteria 1870
30 Ga0157375_10828452 3300013308 Bacteria 1073
31 Ga0163163_10198711 3300014325 Bacteria 2053
32 Ga0206356_11208173 3300020070 Bacteria 570
33 Ga0207707_10009788 3300025912 Bacteria 8313
34 Ga0207707_10932552 3300025912 Bacteria 716
35 Ga0207695_10011242 3300025913 Bacteria 10854
36 Ga0207693_10321776 3300025915 Bacteria 1211
37 Ga0207660_10013282 3300025917 Bacteria 5396
38 Ga0207657_10642501 3300025919 Bacteria 826
39 Ga0207657_10752139 3300025919 Bacteria 755
40 Ga0207652_10000687 3300025921 Bacteria 32979
41 Ga0207652_10220767 3300025921 Bacteria 1708
42 Ga0207652_10561049 3300025921 Bacteria 1026
43 Ga0207664_10002561 3300025929 Bacteria 12017
44 Ga0207664_10009560 3300025929 Bacteria 6808
45 Ga0207664_10267768 3300025929 Bacteria 1496
46 Ga0207690_10744437 3300025932 Bacteria 808
47 Ga0207706_10000012 3300025933 Bacteria 195475
48 Ga0207706_11252308 3300025933 Unclassified 615
49 Ga0207669_10273182 3300025937 Bacteria 1271
50 Ga0207661_10644361 3300025944 Bacteria 974
51 Ga0207677_10000519 3300026023 Bacteria 24757
52 Ga0207677_10109005 3300026023 Bacteria 2058
53 Ga0207702_10088349 3300026078 Bacteria 2707
54 Ga0207641_10950776 3300026088 Bacteria 855
55 Ga0265327_10144543 3300031251 Bacteria 1109
56 Ga0307408_100060355 3300031548 Bacteria 2764
57 Ga0307405_10251027 3300031731 Bacteria 1316
58 Ga0307413_10058105 3300031824 Bacteria 2369
59 Ga0307413_10071190 3300031824 Bacteria 2190
60 Ga0307413_10173123 3300031824 Bacteria 1530
61 Ga0307410_10166318 3300031852 Bacteria 1657
62 Ga0307406_10101346 3300031901 Bacteria 1962
63 Ga0307406_10217711 3300031901 Bacteria 1417
64 Ga0307406_10596520 3300031901 Bacteria 910
65 Ga0307406_10605326 3300031901 Bacteria 904
66 Ga0307406_10625908 3300031901 Bacteria 890
67 Ga0307407_10013942 3300031903 Bacteria 3918
68 Ga0307407_10176993 3300031903 Bacteria 1410
69 Ga0307407_10970371 3300031903 Bacteria 655
70 Ga0307412_10070069 3300031911 Bacteria 2389
71 Ga0307412_10576133 3300031911 Bacteria 949
72 Ga0307412_11185565 3300031911 Bacteria 683
73 Ga0307409_100013925 3300031995 Bacteria 5203
74 Ga0307409_100054779 3300031995 Bacteria 3074
75 Ga0307416_100001133 3300032002 Bacteria 14326
76 Ga0307416_100075520 3300032002 Bacteria 2820
77 Ga0307416_100141317 3300032002 Bacteria 2188
78 Ga0307414_11690824 3300032004 Bacteria 590
79 Ga0307411_10106345 3300032005 Bacteria 1997
80 Ga0307415_100000788 3300032126 Bacteria 14368
81 Ga0307415_100038013 3300032126 Bacteria 3168
82 Ga0307415_100046013 3300032126 Bacteria 2929
83 Ga0373935_0900560 3300035692 Bacteria 655
84 Ga0373947_0592811 3300035725 Bacteria 755
85 Ga0395900_0660912 3300037418 Bacteria 981
86 Ga0395905_1465955 3300037471 Bacteria 587
87 Ga0395901_0039999 3300038443 Bacteria 4854
88 Ga0395901_0129335 3300038443 Bacteria 2654
89 Ga0395901_0907927 3300038443 Bacteria 862
90 Ga0395901_1194911 3300038443 Bacteria 727
91 Ga0439443_074833 3300042003 Bacteria 623
92 Ga0439450_049800 3300042008 Bacteria 993
93 Ga0466966_0099092 3300044684 Bacteria 1804
94 Ga0466966_0114807 3300044684 Bacteria 1658
95 Ga0466961_0049156 3300044693 Bacteria 2696
96 Ga0466971_0375834 3300044719 Bacteria 690
97 Ga0466968_0051659 3300044735 Bacteria 1757
98 Ga0466957_0040090 3300044842 Bacteria 2828
99 Ga0466960_0022468 3300044901 Unclassified 2821
100 Ga0466960_0069225 3300044901 Bacteria 1753
101 Ga0466960_0105079 3300044901 Bacteria 1459
102 Ga0466959_0073927 3300045049 Bacteria 2465
103 Ga0466958_0023787 3300045836 Bacteria 3600
104 Ga0466967_0305335 3300045976 Bacteria 1532
105 Ga0466967_1632513 3300045976 Bacteria 642
106 Ga0495603_0134260 3300046455 Bacteria 1441
107 Ga0495641_0042770 3300046461 Bacteria 2098
108 Ga0495608_0795744 3300046511 Bacteria 558
109 Ga0495586_0669408 3300046535 Unclassified 599
110 Ga0495598_0339830 3300046537 Bacteria 576
111 Ga0495658_0671944 3300046683 Bacteria 663
112 Ga0495600_0160163 3300046809 Bacteria 1455
113 Ga0495581_0525904 3300047315 Bacteria 687
114 Ga0495604_0000063 3300047317 Bacteria 92821
115 Ga0495674_0658755 3300047319 Unclassified 825
116 Ga0495684_0237720 3300047471 Bacteria 1330
117 Ga0495602_0135530 3300048088 Bacteria 1957
118 Ga0496100_0564158 3300048903 Bacteria 882
119 Ga0496101_1495445 3300048904 Bacteria 526
120 Ga0496102_0000002 3300048905 Bacteria 814588
121 Ga0496102_0044295 3300048905 Bacteria 4038
122 Ga0496103_0000047 3300048906 Bacteria 161130
123 Ga0496103_0313004 3300048906 Bacteria 1010
124 Ga0496104_0000037 3300048907 Bacteria 178518
125 Ga0496104_0097422 3300048907 Bacteria 2815
126 Ga0496104_0281278 3300048907 Bacteria 1577
127 Ga0496105_0082231 3300048908 Bacteria 2660
128 Ga0496105_0502033 3300048908 Bacteria 952
129 Ga0496105_1320730 3300048908 Bacteria 526
130 Ga0496106_0095331 3300048909 Bacteria 2301
131 Ga0496107_0084123 3300048910 Bacteria 2321
132 Ga0496108_0000650 3300048911 Bacteria 27089
133 Ga0496108_0350642 3300048911 Bacteria 1288
134 Ga0496109_0002586 3300048912 Bacteria 15159
135 Ga0496109_0034409 3300048912 Bacteria 4562
136 Ga0496110_0000360 3300048913 Bacteria 30495
137 Ga0496110_0000684 3300048913 Bacteria 23345
138 Ga0496111_0000059 3300048914 Bacteria 44577
139 Ga0496111_0020046 3300048914 Bacteria 4651
140 Ga0496111_0783854 3300048914 Bacteria 690
141 Ga0496112_0000389 3300048915 Bacteria 28795
142 Ga0496112_0063722 3300048915 Bacteria 3637
143 Ga0496112_0341111 3300048915 Bacteria 1442
144 Ga0496113_0147108 3300048916 Bacteria 1857
145 Ga0496113_0338086 3300048916 Bacteria 1207
146 Ga0496114_0691702 3300048917 Bacteria 895
147 Ga0501047_0335489 3300049581 Unclassified 1350
148 Ga0501048_1346550 3300049582 Bacteria 513
149 Ga0501067_0312814 3300049583 Bacteria 875
150 Ga0501069_0039416 3300049585 Bacteria 2610
151 Ga0501070_0046262 3300049586 Bacteria 3618
152 Ga0501074_0005269 3300049590 Bacteria 9309
153 Ga0501074_0812833 3300049590 Bacteria 659
154 Ga0501079_0109437 3300049741 Bacteria 2146
155 Ga0501080_0046483 3300049742 Bacteria 4041
156 Ga0501083_0078873 3300049744 Bacteria 2184
157 Ga0501035_0654695 3300049822 Unclassified 851
158 Ga0501044_0125281 3300049823 Bacteria 2567
159 nmdc:mga05p37_591162_c1 3300050507 Bacteria 1255
160 nmdc:mga08y16_214238_c1 3300050511 Bacteria 1994
161 nmdc:mga0rr50_1566035_c1 3300050513 Bacteria 556
162 Ga0495655_0000004 3300053083 Bacteria 293683
163 Ga0500628_000037 3300053129 Bacteria 50133
164 Ga0501082_0377453 3300060353 Bacteria 1237
165 Ga0466962_0045613 3300061719 Unclassified 2095

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042008 Ga0439450_049800 Ga0439450_049800_632_907 91
2 3300047471 Ga0495684_0237720 Ga0495684_0237720_565_960 93
3 3300006028 Ga0070717_10078815 Ga0070717_100788152 94
4 3300047319 Ga0495674_0658755 Ga0495674_0658755_302_670 97
5 3300050513 nmdc:mga0rr50_1566035_c1 nmdc:mga0rr50_1566035_c1_11_373 99
6 3300013105 Ga0157369_11912248 Ga0157369_119122482 101
7 3300005518 Ga0070699_101412689 Ga0070699_1014126891 104
8 3300031548 Ga0307408_100060355 Ga0307408_1000603552 104
9 3300031731 Ga0307405_10251027 Ga0307405_102510272 104
10 3300031824 Ga0307413_10071190 Ga0307413_100711902 104
11 3300031852 Ga0307410_10166318 Ga0307410_101663182 104
12 3300031901 Ga0307406_10625908 Ga0307406_106259082 104
13 3300031903 Ga0307407_10013942 Ga0307407_100139424 104
14 3300031911 Ga0307412_10576133 Ga0307412_105761332 104
15 3300031995 Ga0307409_100054779 Ga0307409_1000547792 104
16 3300032002 Ga0307416_100075520 Ga0307416_1000755203 104
17 3300032126 Ga0307415_100046013 Ga0307415_1000460133 104
18 3300046535 Ga0495586_0669408 Ga0495586_0669408_62_427 106
19 3300037418 Ga0395900_0660912 Ga0395900_0660912_336_701 107
20 3300037471 Ga0395905_1465955 Ga0395905_1465955_207_572 107
21 3300038443 Ga0395901_0039999 Ga0395901_0039999_2118_2483 107
22 3300042003 Ga0439443_074833 Ga0439443_074833_104_469 107
23 3300046537 Ga0495598_0339830 Ga0495598_0339830_125_490 107
24 3300048088 Ga0495602_0135530 Ga0495602_0135530_1517_1885 107
25 3300048907 Ga0496104_0000037 Ga0496104_0000037_121954_122319 107
26 3300048908 Ga0496105_0502033 Ga0496105_0502033_570_935 107
27 3300048913 Ga0496110_0000360 Ga0496110_0000360_12364_12729 107
28 3300048914 Ga0496111_0000059 Ga0496111_0000059_31407_31772 107
29 3300005435 Ga0070714_101680635 Ga0070714_1016806351 108
30 3300005535 Ga0070684_102074253 Ga0070684_1020742531 108
31 3300005617 Ga0068859_103087439 Ga0068859_1030874391 108
32 3300006931 Ga0097620_103088484 Ga0097620_1030884841 108
33 3300020070 Ga0206356_11208173 Ga0206356_112081732 108
34 3300025912 Ga0207707_10932552 Ga0207707_109325522 108
35 3300025919 Ga0207657_10752139 Ga0207657_107521392 108
36 3300025921 Ga0207652_10561049 Ga0207652_105610492 108
37 3300031901 Ga0307406_10101346 Ga0307406_101013462 108
38 3300031903 Ga0307407_10970371 Ga0307407_109703712 108
39 3300045976 Ga0466967_1632513 Ga0466967_1632513_11_337 108
40 3300048915 Ga0496112_0341111 Ga0496112_0341111_1036_1362 108
41 3300048915 Ga0496112_0000389 Ga0496112_0000389_5830_6198 109
42 3300014325 Ga0163163_10198711 Ga0163163_101987112 111
43 3300025932 Ga0207690_10744437 Ga0207690_107444372 112
44 3300031824 Ga0307413_10173123 Ga0307413_101731232 112
45 3300031901 Ga0307406_10605326 Ga0307406_106053262 112
46 3300031911 Ga0307412_10070069 Ga0307412_100700693 112
47 3300032002 Ga0307416_100141317 Ga0307416_1001413172 112
48 3300032126 Ga0307415_100038013 Ga0307415_1000380132 112
49 3300038443 Ga0395901_0907927 Ga0395901_0907927_64_408 114
50 3300005435 Ga0070714_100018641 Ga0070714_1000186415 115
51 3300025929 Ga0207664_10009560 Ga0207664_100095608 115
52 3300044693 Ga0466961_0049156 Ga0466961_0049156_1473_1820 115
53 3300044719 Ga0466971_0375834 Ga0466971_0375834_43_390 115
54 3300044735 Ga0466968_0051659 Ga0466968_0051659_87_434 115
55 3300044842 Ga0466957_0040090 Ga0466957_0040090_192_539 115
56 3300045049 Ga0466959_0073927 Ga0466959_0073927_649_996 115
57 3300045836 Ga0466958_0023787 Ga0466958_0023787_499_846 115
58 3300047317 Ga0495604_0000063 Ga0495604_0000063_79933_80298 115
59 3300061719 Ga0466962_0045613 Ga0466962_0045613_1303_1650 115
60 3300009553 Ga0105249_10214881 Ga0105249_102148813 116
61 3300025921 Ga0207652_10220767 Ga0207652_102207673 116
62 3300025933 Ga0207706_11252308 Ga0207706_112523081 116
63 3300025937 Ga0207669_10273182 Ga0207669_102731822 116
64 3300013308 Ga0157375_10828452 Ga0157375_108284522 117
65 3300025944 Ga0207661_10644361 Ga0207661_106443612 118
66 3300044684 Ga0466966_0114807 Ga0466966_0114807_715_1080 118
67 3300045976 Ga0466967_0305335 Ga0466967_0305335_546_902 118
68 3300044901 Ga0466960_0069225 Ga0466960_0069225_925_1287 119
69 3300031901 Ga0307406_10217711 Ga0307406_102177112 120
70 3300031911 Ga0307412_11185565 Ga0307412_111855652 120
71 3300031995 Ga0307409_100013925 Ga0307409_1000139254 120
72 3300032002 Ga0307416_100001133 Ga0307416_1000011333 120
73 3300032005 Ga0307411_10106345 Ga0307411_101063453 120
74 3300032126 Ga0307415_100000788 Ga0307415_1000007883 120
75 3300005329 Ga0070683_100350840 Ga0070683_1003508403 121
76 3300005336 Ga0070680_100048244 Ga0070680_1000482443 121
77 3300005338 Ga0068868_100000082 Ga0068868_1000000827 121
78 3300005354 Ga0070675_100499328 Ga0070675_1004993282 121
79 3300005435 Ga0070714_100786079 Ga0070714_1007860792 121
80 3300005457 Ga0070662_100000004 Ga0070662_10000000478 121
81 3300005458 Ga0070681_10010572 Ga0070681_1001057211 121
82 3300005530 Ga0070679_100002508 Ga0070679_10000250817 121
83 3300005536 Ga0070697_100320742 Ga0070697_1003207422 121
84 3300005547 Ga0070693_100003484 Ga0070693_1000034846 121
85 3300005563 Ga0068855_100130457 Ga0068855_1001304572 121
86 3300005614 Ga0068856_100184217 Ga0068856_1001842173 121
87 3300005614 Ga0068856_100896677 Ga0068856_1008966772 121
88 3300006028 Ga0070717_10859553 Ga0070717_108595532 121
89 3300006880 Ga0075429_100941130 Ga0075429_1009411301 121
90 3300009093 Ga0105240_10006181 Ga0105240_100061818 121
91 3300009094 Ga0111539_10739429 Ga0111539_107394292 121
92 3300009147 Ga0114129_10692263 Ga0114129_106922632 121
93 3300009174 Ga0105241_10413757 Ga0105241_104137572 121
94 3300013307 Ga0157372_10299761 Ga0157372_102997613 121
95 3300025912 Ga0207707_10009788 Ga0207707_100097882 121
96 3300025913 Ga0207695_10011242 Ga0207695_100112428 121
97 3300025915 Ga0207693_10321776 Ga0207693_103217762 121
98 3300025917 Ga0207660_10013282 Ga0207660_100132822 121
99 3300025919 Ga0207657_10642501 Ga0207657_106425012 121
100 3300025921 Ga0207652_10000687 Ga0207652_1000068722 121
101 3300025929 Ga0207664_10002561 Ga0207664_100025612 121
102 3300025929 Ga0207664_10267768 Ga0207664_102677683 121
103 3300025933 Ga0207706_10000012 Ga0207706_10000012140 121
104 3300026023 Ga0207677_10000519 Ga0207677_1000051925 121
105 3300026023 Ga0207677_10109005 Ga0207677_101090053 121
106 3300026078 Ga0207702_10088349 Ga0207702_100883493 121
107 3300026088 Ga0207641_10950776 Ga0207641_109507762 121
108 3300031251 Ga0265327_10144543 Ga0265327_101445432 121
109 3300031824 Ga0307413_10058105 Ga0307413_100581053 121
110 3300031901 Ga0307406_10596520 Ga0307406_105965201 121
111 3300031903 Ga0307407_10176993 Ga0307407_101769933 121
112 3300032004 Ga0307414_11690824 Ga0307414_116908242 121
113 3300035692 Ga0373935_0900560 Ga0373935_0900560_255_620 121
114 3300035725 Ga0373947_0592811 Ga0373947_0592811_17_382 121
115 3300038443 Ga0395901_0129335 Ga0395901_0129335_1415_1780 121
116 3300038443 Ga0395901_1194911 Ga0395901_1194911_303_668 121
117 3300044684 Ga0466966_0099092 Ga0466966_0099092_608_973 121
118 3300044901 Ga0466960_0022468 Ga0466960_0022468_458_826 121
119 3300044901 Ga0466960_0105079 Ga0466960_0105079_1028_1396 121
120 3300046455 Ga0495603_0134260 Ga0495603_0134260_214_579 121
121 3300046461 Ga0495641_0042770 Ga0495641_0042770_1121_1486 121
122 3300046511 Ga0495608_0795744 Ga0495608_0795744_18_383 121
123 3300046683 Ga0495658_0671944 Ga0495658_0671944_183_548 121
124 3300046809 Ga0495600_0160163 Ga0495600_0160163_390_755 121
125 3300047315 Ga0495581_0525904 Ga0495581_0525904_283_648 121
126 3300048903 Ga0496100_0564158 Ga0496100_0564158_262_627 121
127 3300048904 Ga0496101_1495445 Ga0496101_1495445_28_393 121
128 3300048905 Ga0496102_0000002 Ga0496102_0000002_34163_34528 121
129 3300048905 Ga0496102_0044295 Ga0496102_0044295_333_698 121
130 3300048906 Ga0496103_0000047 Ga0496103_0000047_115474_115839 121
131 3300048906 Ga0496103_0313004 Ga0496103_0313004_424_789 121
132 3300048907 Ga0496104_0097422 Ga0496104_0097422_1652_2017 121
133 3300048907 Ga0496104_0281278 Ga0496104_0281278_1107_1472 121
134 3300048908 Ga0496105_0082231 Ga0496105_0082231_701_1066 121
135 3300048908 Ga0496105_1320730 Ga0496105_1320730_112_477 121
136 3300048909 Ga0496106_0095331 Ga0496106_0095331_1421_1786 121
137 3300048910 Ga0496107_0084123 Ga0496107_0084123_118_483 121
138 3300048911 Ga0496108_0000650 Ga0496108_0000650_19426_19791 121
139 3300048911 Ga0496108_0350642 Ga0496108_0350642_402_767 121
140 3300048912 Ga0496109_0002586 Ga0496109_0002586_5638_6003 121
141 3300048912 Ga0496109_0034409 Ga0496109_0034409_642_1007 121
142 3300048913 Ga0496110_0000684 Ga0496110_0000684_21217_21582 121
143 3300048914 Ga0496111_0020046 Ga0496111_0020046_1687_2052 121
144 3300048914 Ga0496111_0783854 Ga0496111_0783854_109_474 121
145 3300048915 Ga0496112_0063722 Ga0496112_0063722_3111_3476 121
146 3300048916 Ga0496113_0147108 Ga0496113_0147108_267_632 121
147 3300048916 Ga0496113_0338086 Ga0496113_0338086_81_446 121
148 3300048917 Ga0496114_0691702 Ga0496114_0691702_469_834 121
149 3300049581 Ga0501047_0335489 Ga0501047_0335489_122_487 121
150 3300049582 Ga0501048_1346550 Ga0501048_1346550_127_492 121
151 3300049583 Ga0501067_0312814 Ga0501067_0312814_290_655 121
152 3300049585 Ga0501069_0039416 Ga0501069_0039416_340_705 121
153 3300049586 Ga0501070_0046262 Ga0501070_0046262_2378_2743 121
154 3300049590 Ga0501074_0005269 Ga0501074_0005269_5538_5903 121
155 3300049590 Ga0501074_0812833 Ga0501074_0812833_198_563 121
156 3300049741 Ga0501079_0109437 Ga0501079_0109437_97_462 121
157 3300049742 Ga0501080_0046483 Ga0501080_0046483_2684_3049 121
158 3300049744 Ga0501083_0078873 Ga0501083_0078873_247_612 121
159 3300049822 Ga0501035_0654695 Ga0501035_0654695_40_405 121
160 3300049823 Ga0501044_0125281 Ga0501044_0125281_1637_2002 121
161 3300050507 nmdc:mga05p37_591162_c1 nmdc:mga05p37_591162_c1_382_747 121
162 3300050511 nmdc:mga08y16_214238_c1 nmdc:mga08y16_214238_c1_698_1063 121
163 3300053083 Ga0495655_0000004 Ga0495655_0000004_62593_62958 121
164 3300053129 Ga0500628_000037 Ga0500628_000037_28637_29002 121
165 3300060353 Ga0501082_0377453 Ga0501082_0377453_803_1168 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

8

116

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.8861 2 116
7kkb-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81c with bromide 0.8786 2 116
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.8726 2 118
7kk8-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81t with bromide 0.8622 2 116
5a40-assembly2.cif.gz_C crystal structure of a dual topology fluoride ion channel. 0.8608 2 116
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.97 8 114 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9442 8 114 1.10.287.70
af_Q2FXE5_5_115_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9061 13 114 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8953 9 114 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8885 8 115 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A5B8TZE5-F1-model_v4 Fluoride-specific ion channel FluC 0.9795 2 118 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1Q3NIL5-F1-model_v4 deleted 0.9767 1 116
AF-A0A1E3RS30-F1-model_v4 Fluoride-specific ion channel FluC 0.9749 1 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A6J5Z6G1-F1-model_v4 Unannotated protein 0.9701 1 121 GO:0005886
GO:1903425
AF-A0A552ZDL6-F1-model_v4 Fluoride-specific ion channel FluC 0.9699 4 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Feature Viewer

pLDDT pTM Quality
92.73 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map