F244382

General Info

Members Datasets Scaffolds Average Seq Length
164 127 328 416

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1130181|Ga0436365_1130181_529_1836
Length 435
Sequence VQEKLVSVLLGAIADDFTGATDLCNTLVRRGMKTVQLIDVPAPGAALPEAEAMVIALKSRTIPVDQAIAMSLKALAWLKDAGARQILFKYCSTFDSTDAGNIGPVADALLAALGSDFTLYCPAFPALGRTIFKGYLFVGDVLLSESGMKDHPLTPMRDPSLVRVLQRQTKGKVGLVQHAAMAQGPAGIAAAFAQLRAAGYRHAIVDAVADADLDAIGEAAADLPLITGGSGIALGLPANFRRAGLIGDGGGADRLPKIGGKAAVLSGSCSQATLAQLAHMRERAPVFAIDPLAAAAGADVAGQALAWAADRLGTAPICFAATAPPDQVAAVQQKLGRERGGALIEGVMAEIARGLVPVGVRRLVIAGGETAGAVVQALGVTGLRIGRQIDPGVPWTVSLPTSADQPPLALALKSGNFGAPDFFTRAFAALEEATA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
32 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
33 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
34 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
47 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
51 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
52 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
53 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
57 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
60 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
61 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
66 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
67 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
68 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
69 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
70 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
71 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
72 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
73 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
74 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
75 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
76 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
77 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
79 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
80 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
83 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
84 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
85 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
86 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
87 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
88 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
89 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
90 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
91 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
92 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
93 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
94 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
95 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
96 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
97 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
98 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
99 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
100 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
101 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
102 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
105 2508501050 Microvirga lupini Lut6 Isolate Nodule
106 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
107 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
108 2643221733 Bosea sp. Root381 Isolate Unclassified
109 2643221734 Bosea sp. Root670 Isolate Unclassified
110 2643221736 Bosea sp. Root483D1 Isolate Unclassified
111 2773857925 Microvirga vignae BR3299 Isolate Unclassified
112 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
113 2818991467 Bosea vestrisii 3192 Isolate Unclassified
114 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
115 2841760612 Bosea sp. Tri-49 Isolate Nodule
116 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
117 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
118 2844104063 Bosea sp. Tri-39 Isolate Nodule
119 2851182111 Bosea sp. Tri-44 Isolate Nodule
120 2851246043 Bosea sp. Tri-54 Isolate Nodule
121 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
122 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
123 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
124 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
125 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
126 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
127 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.98
Metatranscriptomes 0
Isolates 14.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.24
Nodule 5.49
Rhizoplane 0
Rhizosphere 61.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1130181 3300039437 Bacteria 2238
2 JGI25159J45721_1007486 3300002987 Bacteria 3124
3 JGI25151J46595_10000022 3300003187 Bacteria 223477
4 JGI25151J46595_10000135 3300003187 Bacteria 98528
5 Ga0055526_1000123 3300003771 Bacteria 68503
6 Ga0055526_1000154 3300003771 Bacteria 60968
7 Ga0055524_1000023 3300003775 Bacteria 221408
8 Ga0055524_1009695 3300003775 Bacteria 3893
9 Ga0065165_1000362 3300005262 Bacteria 74503
10 Ga0070675_100215834 3300005354 Bacteria 1669
11 Ga0070709_10051696 3300005434 Bacteria 2579
12 Ga0070714_100058458 3300005435 Bacteria 3303
13 Ga0070713_100013944 3300005436 Bacteria 5950
14 Ga0070711_100076597 3300005439 Bacteria 2372
15 Ga0070705_100095245 3300005440 Bacteria 1866
16 Ga0070694_100074119 3300005444 Bacteria 2352
17 Ga0070678_100055077 3300005456 Bacteria 2902
18 Ga0070681_10046811 3300005458 Bacteria 4323
19 Ga0070707_100220302 3300005468 Bacteria 1848
20 Ga0070698_100004893 3300005471 Bacteria 14702
21 Ga0070699_100172327 3300005518 Bacteria 1918
22 Ga0070679_100027231 3300005530 Bacteria 5624
23 Ga0070665_100060185 3300005548 Bacteria 3807
24 Ga0068859_100076314 3300005617 Bacteria 3392
25 Ga0068858_100321420 3300005842 Bacteria 1479
26 Ga0081538_10012664 3300005981 Bacteria 6744
27 Ga0070717_10042444 3300006028 Bacteria 3709
28 Ga0070717_10059007 3300006028 Bacteria 3174
29 Ga0075434_100009070 3300006871 Bacteria 9264
30 Ga0097620_100076313 3300006931 Bacteria 3392
31 Ga0099795_10023601 3300007788 Bacteria 2042
32 Ga0111539_10459313 3300009094 Bacteria 1483
33 Ga0171462_1009 3300013250 Bacteria 344993
34 Ga0157380_10018945 3300014326 Bacteria 5122
35 Ga0213872_10029327 3300021361 Bacteria 2523
36 Ga0213875_10000127 3300021388 Bacteria 84034
37 Ga0213875_10001198 3300021388 Bacteria 17709
38 Ga0213875_10003520 3300021388 Bacteria 8896
39 Ga0209130_1000226 3300025284 Bacteria 73970
40 Ga0209025_1000016 3300025294 Bacteria 770739
41 Ga0209025_1000696 3300025294 Bacteria 57362
42 Ga0209564_1000075 3300025295 Bacteria 285760
43 Ga0209564_1000076 3300025295 Bacteria 283602
44 Ga0209256_1000083 3300025299 Bacteria 221460
45 Ga0209256_1000935 3300025299 Bacteria 35510
46 Ga0207707_10112761 3300025912 Bacteria 2377
47 Ga0207707_10137938 3300025912 Bacteria 2132
48 Ga0207693_10002952 3300025915 Bacteria 14722
49 Ga0207693_10154648 3300025915 Bacteria 1804
50 Ga0207663_10006016 3300025916 Bacteria 6169
51 Ga0207663_10208987 3300025916 Bacteria 1413
52 Ga0207659_10147612 3300025926 Bacteria 1833
53 Ga0207687_10064190 3300025927 Bacteria 2603
54 Ga0207665_10088540 3300025939 Bacteria 2142
55 Ga0207708_10185123 3300026075 Bacteria 1654
56 Ga0207683_10040347 3300026121 Bacteria 4073
57 Ga0307516_10119595 3300031730 Bacteria 2427
58 Ga0307413_10159749 3300031824 Bacteria 1582
59 Ga0307410_10065017 3300031852 Bacteria 2508
60 Ga0307406_10059430 3300031901 Bacteria 2461
61 Ga0307412_10016806 3300031911 Bacteria 4368
62 Ga0373954_0011670 3300035118 Bacteria 3897
63 Ga0373954_0030110 3300035118 Bacteria 2502
64 Ga0373956_0029691 3300035119 Bacteria 2386
65 Ga0373933_0009649 3300035724 Bacteria 5275
66 Ga0373933_0038198 3300035724 Bacteria 2821
67 Ga0373947_0081387 3300035725 Bacteria 2005
68 Ga0373937_0002334 3300036401 Bacteria 15823
69 Ga0395905_0087835 3300037471 Bacteria 2915
70 Ga0436364_0013924 3300037853 Bacteria 28152
71 Ga0436364_0232247 3300037853 Bacteria 20408
72 Ga0436364_1230766 3300037853 Bacteria 152032
73 Ga0400483_002675 3300039062 Bacteria 11250
74 Ga0400483_064643 3300039062 Bacteria 2936
75 Ga0400483_126731 3300039062 Bacteria 11770
76 Ga0400483_207375 3300039062 Bacteria 11558
77 Ga0400483_216723 3300039062 Bacteria 8805
78 Ga0436365_0138514 3300039437 Bacteria 2780
79 Ga0436365_0983794 3300039437 Bacteria 2587
80 Ga0436361_0451583 3300039447 Bacteria 7913
81 Ga0436361_1016760 3300039447 Bacteria 1493
82 Ga0436363_1388485 3300039450 Bacteria 1740
83 Ga0436363_1460380 3300039450 Bacteria 2373
84 Ga0436362_0857866 3300039453 Bacteria 4869
85 Ga0439434_0030916 3300042435 Bacteria 1627
86 Ga0453684_0041225 3300044712 Bacteria 6250
87 Ga0495638_0000358 3300046460 Bacteria 56858
88 Ga0495638_0031479 3300046460 Bacteria 3410
89 Ga0495605_0008346 3300046474 Bacteria 5858
90 Ga0495585_0035754 3300046492 Bacteria 2805
91 Ga0495583_0020405 3300046506 Bacteria 3433
92 Ga0495616_0038929 3300046513 Bacteria 2438
93 Ga0495667_0147835 3300046559 Bacteria 1513
94 Ga0495668_0006779 3300046616 Bacteria 7442
95 Ga0495668_0058655 3300046616 Bacteria 2124
96 Ga0495625_0002662 3300046660 Bacteria 19020
97 Ga0495674_0028665 3300047319 Bacteria 5072
98 Ga0495672_0015046 3300047320 Bacteria 5267
99 Ga0496119_0040495 3300048922 Bacteria 2979
100 Ga0496123_0038057 3300048926 Bacteria 3386
101 Ga0496126_0176439 3300048929 Bacteria 1817
102 Ga0495678_030349 3300049459 Bacteria 2263
103 Ga0501034_0066952 3300049571 Bacteria 3605
104 Ga0501038_0054572 3300049574 Bacteria 3437
105 Ga0501039_0014389 3300049575 Bacteria 6059
106 Ga0501042_0114442 3300049578 Bacteria 1942
107 Ga0501043_0046590 3300049579 Bacteria 3410
108 Ga0501046_0015044 3300049580 Bacteria 6508
109 Ga0501047_0018969 3300049581 Bacteria 6597
110 Ga0501047_0023339 3300049581 Bacteria 5941
111 Ga0501070_0089141 3300049586 Bacteria 2553
112 Ga0501071_0049866 3300049587 Bacteria 3014
113 Ga0501071_0164211 3300049587 Bacteria 1661
114 Ga0501075_0022336 3300049591 Bacteria 4621
115 Ga0501077_0080969 3300049593 Bacteria 2057
116 Ga0501077_0093703 3300049593 Bacteria 1904
117 Ga0501079_0014807 3300049741 Bacteria 5946
118 Ga0501080_0056317 3300049742 Bacteria 3662
119 Ga0501080_0160869 3300049742 Bacteria 2073
120 Ga0501080_0184676 3300049742 Bacteria 1918
121 Ga0501080_0203608 3300049742 Bacteria 1816
122 Ga0501080_0348627 3300049742 Bacteria 1337
123 Ga0501081_0036108 3300049743 Bacteria 3368
124 Ga0501083_0050353 3300049744 Bacteria 2804
125 Ga0501083_0060010 3300049744 Bacteria 2542
126 Ga0501083_0226532 3300049744 Bacteria 1218
127 nmdc:mga0n895_8562_c1 3300050512 Bacteria 8868
128 Ga0500610_0002697 3300053079 Bacteria 6615
129 Ga0500578_0101931 3300053086 Bacteria 1816
130 Ga0500556_0000199 3300053104 Bacteria 49258
131 Ga0500557_019051 3300053105 Bacteria 1926
132 Ga0500594_0007795 3300053118 Bacteria 2427
133 Ga0500568_0000331 3300053139 Bacteria 37235
134 Ga0500616_0011676 3300053153 Bacteria 5175
135 Ga0500616_0055328 3300053153 Bacteria 2076
136 Ga0500622_0003327 3300053156 Bacteria 10848
137 Ga0500636_0008611 3300053177 Bacteria 5909
138 Ga0501084_0013193 3300054114 Bacteria 6836
139 Ga0501082_0071807 3300060353 Bacteria 2981
140 Ga0501082_0252039 3300060353 Bacteria 1536
141 Ga0530510_0055072 3300061734 Bacteria 2874
142 2508726801 2508501050 Bacteria 9633614
143 2644192117 2643221634 Bacteria 6705461
144 2644498256 2643221689 Bacteria 6042950
145 2644727772 2643221733 Bacteria 5690728
146 2644733574 2643221734 Bacteria 5365412
147 2644744505 2643221736 Bacteria 6608466
148 2774871546 2773857925 Bacteria 6472445
149 2776258220 2775506901 Bacteria 9631051
150 2819717167 2818991467 Bacteria 5893227
151 2830079303 2830075706 Bacteria 3855215
152 2841763284 2841760612 Bacteria 6454112
153 2841917210 2841911363 Bacteria 6173697
154 2841922831 2841917233 Bacteria 6173500
155 2844108846 2844104063 Bacteria 6440972
156 2851182530 2851182111 Bacteria 6047226
157 2851250953 2851246043 Bacteria 6439203
158 2883296474 2883291878 Bacteria 5894118
159 2883359170 2883354860 Bacteria 5865246
160 2894233611 2894232714 Bacteria 8834183
161 2917701346 2917699015 Bacteria 7043791
162 2996314912 2996310559 Bacteria 6357320
163 8057135785 8057132660 Bacteria 4061191
164 8057534792 8057529695 Bacteria 6306553
165 Ga0436365_1130181
166 JGI25159J45721_1007486
167 JGI25151J46595_10000022
168 JGI25151J46595_10000135
169 Ga0055526_1000123
170 Ga0055526_1000154
171 Ga0055524_1000023
172 Ga0055524_1009695
173 Ga0065165_1000362
174 Ga0070675_100215834
175 Ga0070709_10051696
176 Ga0070714_100058458
177 Ga0070713_100013944
178 Ga0070711_100076597
179 Ga0070705_100095245
180 Ga0070694_100074119
181 Ga0070678_100055077
182 Ga0070681_10046811
183 Ga0070707_100220302
184 Ga0070698_100004893
185 Ga0070699_100172327
186 Ga0070679_100027231
187 Ga0070665_100060185
188 Ga0068859_100076314
189 Ga0068858_100321420
190 Ga0081538_10012664
191 Ga0070717_10042444
192 Ga0070717_10059007
193 Ga0075434_100009070
194 Ga0097620_100076313
195 Ga0099795_10023601
196 Ga0111539_10459313
197 Ga0171462_1009
198 Ga0157380_10018945
199 Ga0213872_10029327
200 Ga0213875_10000127
201 Ga0213875_10001198
202 Ga0213875_10003520
203 Ga0209130_1000226
204 Ga0209025_1000016
205 Ga0209025_1000696
206 Ga0209564_1000075
207 Ga0209564_1000076
208 Ga0209256_1000083
209 Ga0209256_1000935
210 Ga0207707_10112761
211 Ga0207707_10137938
212 Ga0207693_10002952
213 Ga0207693_10154648
214 Ga0207663_10006016
215 Ga0207663_10208987
216 Ga0207659_10147612
217 Ga0207687_10064190
218 Ga0207665_10088540
219 Ga0207708_10185123
220 Ga0207683_10040347
221 Ga0307516_10119595
222 Ga0307413_10159749
223 Ga0307410_10065017
224 Ga0307406_10059430
225 Ga0307412_10016806
226 Ga0373954_0011670
227 Ga0373954_0030110
228 Ga0373956_0029691
229 Ga0373933_0009649
230 Ga0373933_0038198
231 Ga0373947_0081387
232 Ga0373937_0002334
233 Ga0395905_0087835
234 Ga0436364_0013924
235 Ga0436364_0232247
236 Ga0436364_1230766
237 Ga0400483_002675
238 Ga0400483_064643
239 Ga0400483_126731
240 Ga0400483_207375
241 Ga0400483_216723
242 Ga0436365_0138514
243 Ga0436365_0983794
244 Ga0436361_0451583
245 Ga0436361_1016760
246 Ga0436363_1388485
247 Ga0436363_1460380
248 Ga0436362_0857866
249 Ga0439434_0030916
250 Ga0453684_0041225
251 Ga0495638_0000358
252 Ga0495638_0031479
253 Ga0495605_0008346
254 Ga0495585_0035754
255 Ga0495583_0020405
256 Ga0495616_0038929
257 Ga0495667_0147835
258 Ga0495668_0006779
259 Ga0495668_0058655
260 Ga0495625_0002662
261 Ga0495674_0028665
262 Ga0495672_0015046
263 Ga0496119_0040495
264 Ga0496123_0038057
265 Ga0496126_0176439
266 Ga0495678_030349
267 Ga0501034_0066952
268 Ga0501038_0054572
269 Ga0501039_0014389
270 Ga0501042_0114442
271 Ga0501043_0046590
272 Ga0501046_0015044
273 Ga0501047_0018969
274 Ga0501047_0023339
275 Ga0501070_0089141
276 Ga0501071_0049866
277 Ga0501071_0164211
278 Ga0501075_0022336
279 Ga0501077_0080969
280 Ga0501077_0093703
281 Ga0501079_0014807
282 Ga0501080_0056317
283 Ga0501080_0160869
284 Ga0501080_0184676
285 Ga0501080_0203608
286 Ga0501080_0348627
287 Ga0501081_0036108
288 Ga0501083_0050353
289 Ga0501083_0060010
290 Ga0501083_0226532
291 nmdc:mga0n895_8562_c1
292 Ga0500610_0002697
293 Ga0500578_0101931
294 Ga0500556_0000199
295 Ga0500557_019051
296 Ga0500594_0007795
297 Ga0500568_0000331
298 Ga0500616_0011676
299 Ga0500616_0055328
300 Ga0500622_0003327
301 Ga0500636_0008611
302 Ga0501084_0013193
303 Ga0501082_0071807
304 Ga0501082_0252039
305 Ga0530510_0055072
306 2508726801
307 2644192117
308 2644498256
309 2644727772
310 2644733574
311 2644744505
312 2774871546
313 2776258220
314 2819717167
315 2830079303
316 2841763284
317 2841917210
318 2841922831
319 2844108846
320 2851182530
321 2851250953
322 2883296474
323 2883359170
324 2894233611
325 2917701346
326 2996314912
327 8057135785
328 8057534792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07005

SBD_N

Sugar-binding N-terminal domain

10

236

0.96

PF17042

NBD_C

Nucleotide-binding C-terminal domain

263

423

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmh-assembly1.cif.gz_A crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.8709 2 393
5dmh-assembly1.cif.gz_A crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.8648 2 393
3dqq-assembly2.cif.gz_B the crystal structure of the putative trna synthase from salmonella typhimurium lt2 0.8461 3 389
3dqq-assembly2.cif.gz_B the crystal structure of the putative trna synthase from salmonella typhimurium lt2 0.8301 3 389
5dmh-assembly2.cif.gz_B crystal structure of a domain of unknown function (duf1537) from ralstonia eutropha h16 (h16_a1561), target efi-511666, complex with adp. 0.8144 2 393
ID Description Score Start End Superfamily
5dmhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Putative sugar-binding, N-terminal domain 0.9766 2 241 3.40.50.10840
5dmhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Putative sugar-binding, N-terminal domain 0.9643 2 241 3.40.50.10840
af_Q46889_243_386_3.40.980.20 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.8756 252 351 3.40.980.20
5dmhA02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.8444 247 393 3.40.980.20
3dqqB02 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;Four-carbon acid sugar kinase, nucleotide binding domain 0.7881 249 389 3.40.980.20
ID Description Score Start End GO Terms
AF-A0A4Q5R2L9-F1-model_v4 Four-carbon acid sugar kinase family protein 0.9793 2 228 GO:0016301
AF-A0A7W4G6K6-F1-model_v4 deleted 0.9723 38 229
AF-A0A6B2M3N0-F1-model_v4 Four-carbon acid sugar kinase family protein 0.97 82 202 GO:0016301
AF-A0A4Q3JHZ3-F1-model_v4 Four-carbon acid sugar kinase family protein 0.9697 2 221 GO:0016301
AF-A0A317C029-F1-model_v4 Four-carbon acid sugar kinase N-terminal domain-containing protein 0.9692 1 202

Map