F244362

General Info

Members Datasets Scaffolds Average Seq Length
164 129 164 102

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_1444866|Ga0395905_1444866_82_513
Length 122
Sequence VRIELAHYLVLSGVLFSIGAAGFLVRRNALVALMSIELMLNAVNLTLIAFNRWQPIVDMPVRQAANAATVVGIPMIPHHGQVFAFFVIAVAAAEAAVGLAIVLSLYRVRKVVRTDDANLLKE

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
52 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
55 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
56 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
57 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
58 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
59 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
79 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
83 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
84 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
94 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
110 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
113 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
114 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
129 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.95
Metatranscriptomes 3.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 0.61
Rhizosphere 95.12
Stem 0
Stem Tuber 0
Unclassified 3.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000551 3300003203 Bacteria 17619
2 JGI25406J46586_10001262 3300003203 Bacteria 11872
3 JGI25406J46586_10163843 3300003203 Bacteria 648
4 rootH1_10158236 3300003323 Bacteria 1145
5 Ga0058859_11724148 3300004798 Bacteria 2279
6 Ga0065704_10638504 3300005289 Unclassified 588
7 Ga0070683_100287177 3300005329 Bacteria 1565
8 Ga0070683_100337200 3300005329 Bacteria 1436
9 Ga0070690_101284819 3300005330 Bacteria 586
10 Ga0070670_100283972 3300005331 Bacteria 1445
11 Ga0068868_101152666 3300005338 Bacteria 715
12 Ga0070689_100843398 3300005340 Bacteria 808
13 Ga0070674_100217706 3300005356 Bacteria 1484
14 Ga0070710_10682369 3300005437 Unclassified 723
15 Ga0070700_100291161 3300005441 Bacteria 1188
16 Ga0070663_100725578 3300005455 Bacteria 847
17 Ga0070678_101827729 3300005456 Bacteria 573
18 Ga0070662_101077591 3300005457 Unclassified 689
19 Ga0070707_100802722 3300005468 Bacteria 905
20 Ga0070698_100658029 3300005471 Bacteria 989
21 Ga0070699_100330533 3300005518 Bacteria 1371
22 Ga0070704_100367998 3300005549 Bacteria 1218
23 Ga0070702_100614719 3300005615 Bacteria 817
24 Ga0070702_101805487 3300005615 Bacteria 511
25 Ga0068861_100831911 3300005719 Bacteria 869
26 Ga0068863_101499128 3300005841 Unclassified 683
27 Ga0068860_100772761 3300005843 Bacteria 973
28 Ga0081455_10032518 3300005937 Bacteria 4699
29 Ga0081539_10000074 3300005985 Bacteria 231435
30 Ga0081539_10001558 3300005985 Bacteria 38098
31 Ga0081539_10001853 3300005985 Bacteria 33320
32 Ga0081539_10179139 3300005985 Bacteria 996
33 Ga0070716_101072472 3300006173 Bacteria 641
34 Ga0097621_100118594 3300006237 Bacteria 2243
35 Ga0075431_102004356 3300006847 Bacteria 534
36 Ga0075433_10149209 3300006852 Bacteria 2079
37 Ga0105240_10670673 3300009093 Bacteria 1134
38 Ga0111539_10016318 3300009094 Bacteria 9207
39 Ga0111539_10024995 3300009094 Bacteria 7320
40 Ga0114129_10552353 3300009147 Bacteria 1497
41 Ga0105242_12371389 3300009176 Bacteria 578
42 Ga0105242_12471896 3300009176 Bacteria 567
43 Ga0105249_10494638 3300009553 Bacteria 1267
44 Ga0105249_11610357 3300009553 Bacteria 722
45 Ga0105239_11465458 3300010375 Bacteria 788
46 Ga0105246_12329221 3300011119 Bacteria 524
47 Ga0157319_1028445 3300012497 Bacteria 590
48 Ga0157372_12810306 3300013307 Bacteria 558
49 Ga0182008_10934397 3300014497 Bacteria 513
50 Ga0157376_11392117 3300014969 Bacteria 733
51 Ga0207692_10524713 3300025898 Unclassified 754
52 Ga0207663_11086862 3300025916 Bacteria 643
53 Ga0207646_10744323 3300025922 Bacteria 875
54 Ga0207686_11442741 3300025934 Bacteria 567
55 Ga0207689_11214936 3300025942 Bacteria 634
56 Ga0207677_11402076 3300026023 Bacteria 644
57 Ga0207678_11056534 3300026067 Bacteria 719
58 Ga0207708_10398760 3300026075 Bacteria 1137
59 Ga0207676_10140197 3300026095 Bacteria 2069
60 Ga0209981_1036570 3300027378 Bacteria 728
61 Ga0207428_10068970 3300027907 Bacteria 2780
62 Ga0207428_10545774 3300027907 Bacteria 839
63 Ga0268265_11785605 3300028380 Bacteria 621
64 Ga0268264_12007619 3300028381 Unclassified 587
65 Ga0265331_10235756 3300031250 Bacteria 821
66 Ga0316575_10001209 3300031665 Bacteria 8171
67 Ga0316575_10013354 3300031665 Bacteria 3067
68 Ga0316579_10064189 3300031691 Bacteria 1732
69 Ga0316576_10026433 3300031727 Bacteria 4073
70 Ga0316576_10435680 3300031727 Bacteria 969
71 Ga0316576_10792990 3300031727 Bacteria 682
72 Ga0316578_10007994 3300031728 Bacteria 5347
73 Ga0316577_10023718 3300031733 Bacteria 3407
74 Ga0316577_10289373 3300031733 Bacteria 928
75 Ga0307416_101053992 3300032002 Bacteria 917
76 Ga0307411_10616828 3300032005 Bacteria 935
77 Ga0307415_101058502 3300032126 Bacteria 757
78 Ga0316585_10001729 3300032137 Bacteria 5812
79 Ga0373936_0022786 3300035113 Bacteria 2439
80 Ga0373956_0102161 3300035119 Bacteria 1331
81 Ga0316574_0002475 3300035398 Bacteria 9279
82 Ga0316574_0037725 3300035398 Bacteria 2964
83 Ga0316574_0590298 3300035398 Bacteria 687
84 Ga0373931_0292125 3300035691 Bacteria 1004
85 Ga0373935_0783975 3300035692 Bacteria 703
86 Ga0373927_0100623 3300035695 Bacteria 1879
87 Ga0373927_0481477 3300035695 Bacteria 820
88 Ga0373933_0184354 3300035724 Bacteria 1332
89 Ga0373947_1189649 3300035725 Bacteria 519
90 Ga0373937_1234372 3300036401 Bacteria 696
91 Ga0316582_0450321 3300036647 Bacteria 887
92 Ga0316582_0508863 3300036647 Unclassified 830
93 Ga0316584_0045584 3300036712 Bacteria 3273
94 Ga0316584_0695105 3300036712 Bacteria 698
95 Ga0373925_0062096 3300037068 Bacteria 2809
96 Ga0395905_0098221 3300037471 Bacteria 2750
97 Ga0395905_1444866 3300037471 Unclassified 592
98 Ga0395905_1726684 3300037471 Bacteria 531
99 Ga0436365_1766257 3300039437 Bacteria 734
100 Ga0436360_0401391 3300039438 Bacteria 729
101 Ga0436360_0919343 3300039438 Bacteria 884
102 Ga0436361_0311165 3300039447 Bacteria 1077
103 Ga0436363_0501989 3300039450 Bacteria 586
104 Ga0436362_0972986 3300039453 Bacteria 761
105 Ga0439431_0073910 3300041997 Bacteria 912
106 Ga0439450_140933 3300042008 Bacteria 629
107 Ga0439458_0057738 3300042157 Bacteria 965
108 Ga0451577_0497788 3300042876 Bacteria 1106
109 Ga0451577_0749651 3300042876 Bacteria 883
110 Ga0451577_0774618 3300042876 Bacteria 867
111 Ga0466969_0393831 3300044656 Bacteria 629
112 Ga0453683_0513133 3300044673 Bacteria 778
113 Ga0466966_0555647 3300044684 Bacteria 691
114 Ga0453684_0320831 3300044712 Bacteria 1755
115 Ga0451576_0357806 3300045051 Bacteria 1528
116 Ga0451576_0602533 3300045051 Bacteria 1155
117 Ga0451576_1008539 3300045051 Bacteria 872
118 Ga0495629_1124400 3300046459 Bacteria 507
119 Ga0495653_0009582 3300046463 Bacteria 7922
120 Ga0495664_0334071 3300046477 Bacteria 913
121 Ga0495640_0257778 3300046533 Bacteria 1090
122 Ga0495586_0103910 3300046535 Bacteria 1578
123 Ga0495600_0108201 3300046809 Bacteria 1811
124 Ga0495684_0954954 3300047471 Bacteria 548
125 Ga0496104_1507924 3300048907 Bacteria 575
126 Ga0496117_0406082 3300048920 Bacteria 686
127 Ga0501340_023284 3300049556 Bacteria 530
128 Ga0501032_0079677 3300049569 Bacteria 2180
129 Ga0501038_0143352 3300049574 Bacteria 1952
130 Ga0501043_0210421 3300049579 Bacteria 1507
131 Ga0501047_0006640 3300049581 Bacteria 10876
132 Ga0501047_0082305 3300049581 Bacteria 3094
133 Ga0501067_0003558 3300049583 Bacteria 8575
134 Ga0501068_0000146 3300049584 Bacteria 32264
135 Ga0501069_0001426 3300049585 Bacteria 11719
136 Ga0501070_0039034 3300049586 Bacteria 3962
137 Ga0501072_0000060 3300049588 Bacteria 79259
138 Ga0501073_0078147 3300049589 Bacteria 2302
139 Ga0501074_0020176 3300049590 Bacteria 4843
140 Ga0501074_0412211 3300049590 Bacteria 958
141 Ga0501076_0126339 3300049592 Bacteria 2072
142 Ga0501076_1559668 3300049592 Bacteria 542
143 Ga0501077_0029549 3300049593 Bacteria 3484
144 Ga0501077_0571600 3300049593 Bacteria 726
145 Ga0501079_0008362 3300049741 Bacteria 7841
146 Ga0501079_1282157 3300049741 Bacteria 577
147 Ga0501080_0202188 3300049742 Bacteria 1823
148 Ga0501083_0038676 3300049744 Bacteria 3242
149 Ga0501083_0865498 3300049744 Bacteria 588
150 Ga0501044_0096077 3300049823 Bacteria 2985
151 nmdc:mga08y16_10786_c1 3300050511 Bacteria 9591
152 nmdc:mga08y16_23517_c1 3300050511 Bacteria 6511
153 nmdc:mga0n895_994441_c1 3300050512 Bacteria 820
154 nmdc:mga0a205_48168_c1 3300050515 Bacteria 4113
155 Ga0495595_0389978 3300053084 Bacteria 705
156 Ga0500643_002247 3300053087 Bacteria 10173
157 Ga0500608_162386 3300053122 Bacteria 967
158 Ga0501084_0000476 3300054114 Bacteria 30678
159 Ga0587084_019043 3300059477 Bacteria 1007
160 Ga0587077_054678 3300059493 Bacteria 846
161 Ga0587062_116354 3300059639 Bacteria 536
162 Ga0501082_0000061 3300060353 Bacteria 77564
163 Ga0501082_0058155 3300060353 Bacteria 3331
164 Ga0530510_0108995 3300061734 Bacteria 2027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_0450321 Ga0316582_0450321_307_654 84
2 3300036712 Ga0316584_0695105 Ga0316584_0695105_102_449 84
3 3300031665 Ga0316575_10013354 Ga0316575_100133542 86
4 3300031691 Ga0316579_10064189 Ga0316579_100641893 86
5 3300031727 Ga0316576_10026433 Ga0316576_100264334 86
6 3300031728 Ga0316578_10007994 Ga0316578_100079945 86
7 3300031733 Ga0316577_10023718 Ga0316577_100237183 86
8 3300032137 Ga0316585_10001729 Ga0316585_100017293 86
9 3300035398 Ga0316574_0002475 Ga0316574_0002475_5479_5826 86
10 3300036712 Ga0316584_0045584 Ga0316584_0045584_679_1026 86
11 3300005441 Ga0070700_100291161 Ga0070700_1002911613 87
12 3300005549 Ga0070704_100367998 Ga0070704_1003679982 87
13 3300009094 Ga0111539_10016318 Ga0111539_100163184 87
14 3300026023 Ga0207677_11402076 Ga0207677_114020762 87
15 3300026075 Ga0207708_10398760 Ga0207708_103987602 87
16 3300027907 Ga0207428_10068970 Ga0207428_100689702 87
17 3300035695 Ga0373927_0481477 Ga0373927_0481477_287_592 87
18 3300046533 Ga0495640_0257778 Ga0495640_0257778_714_1019 87
19 3300050511 nmdc:mga08y16_23517_c1 nmdc:mga08y16_23517_c1_2470_2775 87
20 3300053084 Ga0495595_0389978 Ga0495595_0389978_31_336 87
21 3300031665 Ga0316575_10001209 Ga0316575_100012098 89
22 3300035398 Ga0316574_0037725 Ga0316574_0037725_201_533 89
23 3300036647 Ga0316582_0508863 Ga0316582_0508863_36_368 89
24 3300031733 Ga0316577_10289373 Ga0316577_102893732 93
25 3300005340 Ga0070689_100843398 Ga0070689_1008433982 99
26 3300012497 Ga0157319_1028445 Ga0157319_10284452 99
27 3300044684 Ga0466966_0555647 Ga0466966_0555647_231_530 99
28 3300003203 JGI25406J46586_10000551 JGI25406J46586_1000055111 100
29 3300003203 JGI25406J46586_10001262 JGI25406J46586_100012622 100
30 3300003203 JGI25406J46586_10163843 JGI25406J46586_101638431 100
31 3300003323 rootH1_10158236 rootH1_101582362 100
32 3300004798 Ga0058859_11724148 Ga0058859_117241482 100
33 3300005289 Ga0065704_10638504 Ga0065704_106385042 100
34 3300005329 Ga0070683_100287177 Ga0070683_1002871772 100
35 3300005329 Ga0070683_100337200 Ga0070683_1003372002 100
36 3300005330 Ga0070690_101284819 Ga0070690_1012848192 100
37 3300005331 Ga0070670_100283972 Ga0070670_1002839723 100
38 3300005338 Ga0068868_101152666 Ga0068868_1011526662 100
39 3300005356 Ga0070674_100217706 Ga0070674_1002177062 100
40 3300005437 Ga0070710_10682369 Ga0070710_106823692 100
41 3300005455 Ga0070663_100725578 Ga0070663_1007255782 100
42 3300005456 Ga0070678_101827729 Ga0070678_1018277291 100
43 3300005457 Ga0070662_101077591 Ga0070662_1010775912 100
44 3300005468 Ga0070707_100802722 Ga0070707_1008027222 100
45 3300005471 Ga0070698_100658029 Ga0070698_1006580292 100
46 3300005518 Ga0070699_100330533 Ga0070699_1003305332 100
47 3300005615 Ga0070702_100614719 Ga0070702_1006147192 100
48 3300005615 Ga0070702_101805487 Ga0070702_1018054872 100
49 3300005719 Ga0068861_100831911 Ga0068861_1008319112 100
50 3300005841 Ga0068863_101499128 Ga0068863_1014991281 100
51 3300005843 Ga0068860_100772761 Ga0068860_1007727612 100
52 3300005937 Ga0081455_10032518 Ga0081455_100325186 100
53 3300005985 Ga0081539_10000074 Ga0081539_1000007417 100
54 3300005985 Ga0081539_10001558 Ga0081539_100015582 100
55 3300005985 Ga0081539_10001853 Ga0081539_1000185331 100
56 3300005985 Ga0081539_10179139 Ga0081539_101791393 100
57 3300006173 Ga0070716_101072472 Ga0070716_1010724722 100
58 3300006237 Ga0097621_100118594 Ga0097621_1001185942 100
59 3300006847 Ga0075431_102004356 Ga0075431_1020043561 100
60 3300006852 Ga0075433_10149209 Ga0075433_101492092 100
61 3300009093 Ga0105240_10670673 Ga0105240_106706732 100
62 3300009094 Ga0111539_10024995 Ga0111539_100249958 100
63 3300009147 Ga0114129_10552353 Ga0114129_105523531 100
64 3300009176 Ga0105242_12371389 Ga0105242_123713892 100
65 3300009176 Ga0105242_12471896 Ga0105242_124718962 100
66 3300009553 Ga0105249_10494638 Ga0105249_104946382 100
67 3300009553 Ga0105249_11610357 Ga0105249_116103572 100
68 3300010375 Ga0105239_11465458 Ga0105239_114654582 100
69 3300011119 Ga0105246_12329221 Ga0105246_123292211 100
70 3300013307 Ga0157372_12810306 Ga0157372_128103062 100
71 3300014497 Ga0182008_10934397 Ga0182008_109343971 100
72 3300014969 Ga0157376_11392117 Ga0157376_113921172 100
73 3300025898 Ga0207692_10524713 Ga0207692_105247132 100
74 3300025916 Ga0207663_11086862 Ga0207663_110868621 100
75 3300025922 Ga0207646_10744323 Ga0207646_107443232 100
76 3300025934 Ga0207686_11442741 Ga0207686_114427412 100
77 3300025942 Ga0207689_11214936 Ga0207689_112149362 100
78 3300026067 Ga0207678_11056534 Ga0207678_110565342 100
79 3300026095 Ga0207676_10140197 Ga0207676_101401973 100
80 3300027378 Ga0209981_1036570 Ga0209981_10365702 100
81 3300027907 Ga0207428_10545774 Ga0207428_105457742 100
82 3300028380 Ga0268265_11785605 Ga0268265_117856051 100
83 3300028381 Ga0268264_12007619 Ga0268264_120076192 100
84 3300031250 Ga0265331_10235756 Ga0265331_102357561 100
85 3300031727 Ga0316576_10435680 Ga0316576_104356802 100
86 3300031727 Ga0316576_10792990 Ga0316576_107929902 100
87 3300032002 Ga0307416_101053992 Ga0307416_1010539922 100
88 3300032005 Ga0307411_10616828 Ga0307411_106168282 100
89 3300032126 Ga0307415_101058502 Ga0307415_1010585022 100
90 3300035113 Ga0373936_0022786 Ga0373936_0022786_619_948 100
91 3300035119 Ga0373956_0102161 Ga0373956_0102161_634_963 100
92 3300035398 Ga0316574_0590298 Ga0316574_0590298_96_410 100
93 3300035691 Ga0373931_0292125 Ga0373931_0292125_92_403 100
94 3300035692 Ga0373935_0783975 Ga0373935_0783975_302_631 100
95 3300035695 Ga0373927_0100623 Ga0373927_0100623_737_1066 100
96 3300035724 Ga0373933_0184354 Ga0373933_0184354_780_1085 100
97 3300035725 Ga0373947_1189649 Ga0373947_1189649_155_463 100
98 3300036401 Ga0373937_1234372 Ga0373937_1234372_174_503 100
99 3300037068 Ga0373925_0062096 Ga0373925_0062096_1451_1780 100
100 3300037471 Ga0395905_0098221 Ga0395905_0098221_1151_1462 100
101 3300037471 Ga0395905_1444866 Ga0395905_1444866_82_513 100
102 3300037471 Ga0395905_1726684 Ga0395905_1726684_184_492 100
103 3300039437 Ga0436365_1766257 Ga0436365_1766257_273_578 100
104 3300039438 Ga0436360_0401391 Ga0436360_0401391_387_698 100
105 3300039438 Ga0436360_0919343 Ga0436360_0919343_343_645 100
106 3300039447 Ga0436361_0311165 Ga0436361_0311165_329_631 100
107 3300039450 Ga0436363_0501989 Ga0436363_0501989_70_372 100
108 3300039453 Ga0436362_0972986 Ga0436362_0972986_64_366 100
109 3300041997 Ga0439431_0073910 Ga0439431_0073910_484_789 100
110 3300042008 Ga0439450_140933 Ga0439450_140933_282_584 100
111 3300042157 Ga0439458_0057738 Ga0439458_0057738_150_458 100
112 3300042876 Ga0451577_0497788 Ga0451577_0497788_371_673 100
113 3300042876 Ga0451577_0749651 Ga0451577_0749651_481_846 100
114 3300042876 Ga0451577_0774618 Ga0451577_0774618_88_390 100
115 3300044656 Ga0466969_0393831 Ga0466969_0393831_246_557 100
116 3300044673 Ga0453683_0513133 Ga0453683_0513133_395_697 100
117 3300044712 Ga0453684_0320831 Ga0453684_0320831_1147_1449 100
118 3300045051 Ga0451576_0357806 Ga0451576_0357806_411_713 100
119 3300045051 Ga0451576_0602533 Ga0451576_0602533_522_824 100
120 3300045051 Ga0451576_1008539 Ga0451576_1008539_70_381 100
121 3300046459 Ga0495629_1124400 Ga0495629_1124400_25_342 100
122 3300046463 Ga0495653_0009582 Ga0495653_0009582_502_819 100
123 3300046477 Ga0495664_0334071 Ga0495664_0334071_194_511 100
124 3300046535 Ga0495586_0103910 Ga0495586_0103910_350_658 100
125 3300046809 Ga0495600_0108201 Ga0495600_0108201_338_655 100
126 3300047471 Ga0495684_0954954 Ga0495684_0954954_108_425 100
127 3300048907 Ga0496104_1507924 Ga0496104_1507924_67_378 100
128 3300048920 Ga0496117_0406082 Ga0496117_0406082_163_474 100
129 3300049556 Ga0501340_023284 Ga0501340_023284_198_515 100
130 3300049569 Ga0501032_0079677 Ga0501032_0079677_1116_1433 100
131 3300049574 Ga0501038_0143352 Ga0501038_0143352_1383_1700 100
132 3300049579 Ga0501043_0210421 Ga0501043_0210421_259_576 100
133 3300049581 Ga0501047_0006640 Ga0501047_0006640_6880_7197 100
134 3300049581 Ga0501047_0082305 Ga0501047_0082305_305_610 100
135 3300049583 Ga0501067_0003558 Ga0501067_0003558_6876_7193 100
136 3300049584 Ga0501068_0000146 Ga0501068_0000146_719_1036 100
137 3300049585 Ga0501069_0001426 Ga0501069_0001426_3665_3982 100
138 3300049586 Ga0501070_0039034 Ga0501070_0039034_1963_2280 100
139 3300049588 Ga0501072_0000060 Ga0501072_0000060_71957_72274 100
140 3300049589 Ga0501073_0078147 Ga0501073_0078147_375_692 100
141 3300049590 Ga0501074_0020176 Ga0501074_0020176_3144_3461 100
142 3300049590 Ga0501074_0412211 Ga0501074_0412211_614_922 100
143 3300049592 Ga0501076_0126339 Ga0501076_0126339_502_819 100
144 3300049592 Ga0501076_1559668 Ga0501076_1559668_181_483 100
145 3300049593 Ga0501077_0029549 Ga0501077_0029549_2613_2930 100
146 3300049593 Ga0501077_0571600 Ga0501077_0571600_99_401 100
147 3300049741 Ga0501079_0008362 Ga0501079_0008362_1399_1716 100
148 3300049741 Ga0501079_1282157 Ga0501079_1282157_258_566 100
149 3300049742 Ga0501080_0202188 Ga0501080_0202188_1254_1571 100
150 3300049744 Ga0501083_0038676 Ga0501083_0038676_1609_1926 100
151 3300049744 Ga0501083_0865498 Ga0501083_0865498_120_437 100
152 3300049823 Ga0501044_0096077 Ga0501044_0096077_1717_2034 100
153 3300050511 nmdc:mga08y16_10786_c1 nmdc:mga08y16_10786_c1_229_531 100
154 3300050512 nmdc:mga0n895_994441_c1 nmdc:mga0n895_994441_c1_128_430 100
155 3300050515 nmdc:mga0a205_48168_c1 nmdc:mga0a205_48168_c1_619_921 100
156 3300053087 Ga0500643_002247 Ga0500643_002247_2639_2950 100
157 3300053122 Ga0500608_162386 Ga0500608_162386_124_435 100
158 3300054114 Ga0501084_0000476 Ga0501084_0000476_23358_23675 100
159 3300059477 Ga0587084_019043 Ga0587084_019043_117_431 100
160 3300059493 Ga0587077_054678 Ga0587077_054678_477_788 100
161 3300059639 Ga0587062_116354 Ga0587062_116354_104_415 100
162 3300060353 Ga0501082_0000061 Ga0501082_0000061_867_1184 100
163 3300060353 Ga0501082_0058155 Ga0501082_0058155_214_531 100
164 3300061734 Ga0530510_0108995 Ga0530510_0108995_957_1274 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

7

122

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e73-assembly1.cif.gz_4L vigna radiata supercomplex i+iii2 (full bridge) 0.8644 4 88
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.864 3 85
8bef-assembly1.cif.gz_K cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) 0.8588 4 88
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.8587 10 88
5lnk-assembly1.cif.gz_K entire ovine respiratory complex i 0.8568 11 83
ID Description Score Start End Superfamily
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8826 6 88 1.10.287.3510
5lnkK00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8568 11 83 1.10.287.3510
af_Q2G2E1_15_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8514 8 83 1.10.287.3510
af_Q2FZV1_630_695_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8513 14 81 1.10.287.3510
af_P03901_1_98_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8398 8 86 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A535WLR6-F1-model_v4 Uncharacterized protein 0.9101 1 83 GO:0016020
AF-C8XH07-F1-model_v4 Multiple resistance and pH regulation protein F 0.909 4 79 GO:0005886
GO:0015385
AF-A0A845LIG9-F1-model_v4 pH regulation protein F 0.8941 3 82 GO:0005886
GO:0015385
AF-A8ABM2-F1-model_v4 NADH-ubiquinone oxidoreductase, chain 4L 0.8926 4 86 GO:0016020
AF-A0A099F0H4-F1-model_v4 Cation:proton antiporter 0.8926 4 81 GO:0005886
GO:0015385

Feature Viewer

pLDDT pTM Quality
83.96 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map